ABCD_AX012 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P19491 Rattus norvegicus (Rat) UniProt: P42262 Homo sapiens (Human) UniProt: P23819 Mus musculus (Mouse) |
| Target name | GRIA2, GLUR2, Glutamate receptor 2, GluR-2, AMPA-selective glutamate receptor 2, GluR-B, GluR-K2, Glutamate receptor ionotropic AMPA 2, GluA2 |
| Epitope | Sequence:EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI |
| Antibody information | |
| Antibody name | L21/32R |
| Applications | Electron microscopy, Immunohistochemistry, Western blot |
| Cross-references | NeuroMab: L21_32.pdf Addgene: 177480 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |