ABCD_AX014 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P0CC10 Rattus norvegicus (Rat) |
| Target name | Lrrc4b, Lrig4, Leucine-rich repeat-containing protein 4B, Netrin-G3 ligand, NGL-3 |
| Epitope | Sequence:RKQHQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVAGGAGVGGDSHLALPALERDHLNHHHYVAAAFKAHYGGNPGGGCGAKGPGLNSIHEPLLFKSGSKENVQETQI |
| Antibody information | |
| Antibody name | N51/6.2R |
| Applications | Immunohistochemistry, Immunoprecipitation, Western blot |
| Cross-references | NeuroMab: N51_6.pdf Addgene: 114493 |
| Publications | PMID: 30667360 |
| Deposited by | From UC Davis/NIH NeuroMab Facility |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |