Expasy logo

ABCD

ABCD_AX014 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P0CC10 Rattus norvegicus (Rat)
Target name Lrrc4b, Lrig4, Leucine-rich repeat-containing protein 4B, Netrin-G3 ligand, NGL-3
Epitope Sequence:
RKQHQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVAGGAGVGGDSHLALPALERDH
LNHHHYVAAAFKAHYGGNPGGGCGAKGPGLNSIHEPLLFKSGSKENVQETQI
Antibody information
Antibody name N51/6.2R
Applications Immunohistochemistry, Immunoprecipitation, Western blot
Cross-references NeuroMab: N51_6.pdf
Addgene: 114493
Publications PMID: 30667360
Deposited by From UC Davis/NIH NeuroMab Facility
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.