Expasy logo

ABCD

ABCD_AX159 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P35499 Homo sapiens (Human)
UniProt: Q14524 Homo sapiens (Human)
Target name SCN4A, Sodium channel protein type 4 subunit alpha, SkM1, Sodium channel protein skeletal muscle subunit alpha, Sodium channel protein type IV subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.4
SCN5A, Sodium channel protein type 5 subunit alpha, HH1, Sodium channel protein cardiac muscle subunit alpha, Sodium channel protein type V subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.5
Epitope Sequence:
NFNVATEESSEPLGEDDFEMFYETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKI
KLITLDLPMVPGDKIHCLDILFALTKEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPIT
TTLKRKHEEVCAIKIQRAYRRHLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKM
YGHENGNSSSPSPEEKGEAGDAGPTMGLMPISPSDTAWPPAPPPGQTVRPGVKESLV
Antibody information
Antibody name anti-NaV1.4-Nb17
Applications Biolayer interferometry, ELISA, FRET assay
Publications PMID: 35202650
Binder Format Nanobody
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).