Expasy logo

ABCD

ABCD_AX644 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q9NZQ7 Homo sapiens (Human)
Target name Programmed cell death 1 ligand 1, PD-L1, PDCD1 ligand 1, Programmed death ligand 1, hPD-L1, B7 homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1
Epitope Sequence:
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQ
HSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY
This antibody binds specifically to the extracellular Ig-like V-type domain (residues 18-134)
Antibody information
Antibody name anti-PD-L1 VHH6
Antibody synonyms VHH6
Comments This antibody is able to block PD-1/PD-L1 interaction.
Applications ELISA, Biolayer interferometry, X-ray crystallography
Cross-references PDB: 8AOK
Publications PMID: 36470427
Binder Format Nanobody
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.