| Antigen information |
|---|
| Target type |
Protein
|
|---|
| Target link |
UniProt: P19438 Homo sapiens (Human)
|
|---|
| Target name |
Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1 (TNF-R1), Tumor necrosis factor receptor type I (TNF-RI, TNFR-I), p55, p60, TNFRSF1A, TNFAR, TNFR1
|
|---|
| Epitope |
Sequence:LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
|
|---|
| Antibody information |
|---|
| Antibody name |
TAR2h-89
|
|---|
| Comments |
Caution: This entry contains unknown (Xaa) aminoacids.
|
|---|
| Applications |
ELISA, Surface plasmon resonance
|
|---|
| Publications |
Patent: WO2007063311
|
|---|
| Binder Format |
Single-domain antibody (sdAb)
|
|---|
| Would you like to obtain this antibody? |
|---|
It can be produced at the Geneva Antibody facility (for more information, please check here).
|
