ABCD_AY732 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9NP84 Homo sapiens (Human) |
| Target name | Tumor necrosis factor receptor superfamily member 12A, Fibroblast growth factor-inducible immediate-early response protein 14 (FGF-inducible 14), Tweak-receptor (TweakR), CD266, TNFRSF12A, FN14 |
| Epitope | Extracellular domain Recognizes a conformational epitope dependent on disulphide bond formation within Fn14 Sequence:EQAPGTAPCSRGSSASADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL |
| Antibody information | |
| Antibody name | CRCBT-06-004 |
| Antibody synonyms | Anti-Fn14 CRCBT-06-004 |
| Applications | ELISA, Western blot, Flow cytometry |
| Cross-references | Cellosaurus: CVCL_C5R8 |
| Publications | Patent: WO2013026099 |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |