ABCD_AY733 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9NP84 Homo sapiens (Human) |
| Target name | Tumor necrosis factor receptor superfamily member 12A, Fibroblast growth factor-inducible immediate-early response protein 14 (FGF-inducible 14), Tweak-receptor (TweakR), CD266, TNFRSF12A, FN14 |
| Epitope | Extracellular domain Recognizes a conformational epitope dependent on disulphide bond formation within Fn14 Sequence:EQAPGTAPCSRGSSASADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL |
| Antibody information | |
| Antibody name | CRCBT-06-005 |
| Antibody synonyms | Anti-Fn14 CRCBT-06-005 |
| Applications | ELISA, Western blot, Flow cytometry |
| Cross-references | Cellosaurus: CVCL_C5R9 |
| Publications | Patent: WO2013026099 |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |