Expasy logo

ABCD

ABCD_AY799 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q53EL9 Homo sapiens (Human)
Target name Seizure protein 6 homolog, SEZ-6, hSEZ-6, SEZ6
Epitope Sequence:
TSCHDPGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKWSDRAP
KCLL
Antibody information
Antibody name SC17.17
Antibody synonyms Anti SEZ6, SEZ6 modulator
Applications ELISA, Flow cytometry
Publications Patent: WO2013126810
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.