ABCD_AY799 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q53EL9 Homo sapiens (Human) |
| Target name | Seizure protein 6 homolog, SEZ-6, hSEZ-6, SEZ6 |
| Epitope | Sequence:TSCHDPGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKWSDRAPKCLL |
| Antibody information | |
| Antibody name | SC17.17 |
| Antibody synonyms | Anti SEZ6, SEZ6 modulator |
| Applications | ELISA, Flow cytometry |
| Publications | Patent: WO2013126810 |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |