ABCD_BC337 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P01138 Homo sapiens (Human) UniProt: P25427 Rattus norvegicus (Rat) UniProt: Q531B0 Canis lupus familiaris (Dog) (Canis familiaris) |
| Target name | NGF, NGFB, Beta-nerve growth factor, Beta-NGF |
| Epitope | Sequence:SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
| Antibody information | |
| Antibody name | anti-NGF antibody PR-1254972 |
| Antibody synonyms | PR-1254972, Hybridoma M1129-20B10.3F4 derived |
| Comments | inhibits NGF activity (Patent: US10093725) |
| Applications | ELISA, Surface plasmon resonance |
| Cross-references | Cellosaurus: CVCL_E2YJ |
| Publications | Patent: US10093725 |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |