ABCD_BC338 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P01138 Homo sapiens (Human) UniProt: P25427 Rattus norvegicus (Rat) UniProt: Q531B0 Canis lupus familiaris (Dog) (Canis familiaris) |
| Target name | NGF, NGFB, Beta-nerve growth factor, Beta-NGF |
| Epitope | Sequence:SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
| Antibody information | |
| Antibody name | anti-NGF antibody PR-1254973 |
| Antibody synonyms | PR-1254973, Hybridoma M1129-2B12.5G9 derived |
| Comments | inhibits NGF activity (Patent: US10093725) |
| Applications | ELISA, Surface plasmon resonance |
| Cross-references | Cellosaurus: CVCL_E2YK |
| Publications | Patent: US10093725 |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |