Expasy logo

ABCD

ABCD_BC338 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P01138 Homo sapiens (Human)
UniProt: P25427 Rattus norvegicus (Rat)
UniProt: Q531B0 Canis lupus familiaris (Dog) (Canis familiaris)
Target name NGF, NGFB, Beta-nerve growth factor, Beta-NGF
Epitope Sequence:
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRD
PNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Antibody information
Antibody name anti-NGF antibody PR-1254973
Antibody synonyms PR-1254973, Hybridoma M1129-2B12.5G9 derived
Comments inhibits NGF activity (Patent: US10093725)
Applications ELISA, Surface plasmon resonance
Cross-references Cellosaurus: CVCL_E2YK
Publications Patent: US10093725
Would you like to obtain this antibody?
It can be produced at the Geneva Antibody facility (for more information, please check here).