Expasy logo

ABCD

ABCD_BC341 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P01138 Homo sapiens (Human)
UniProt: P25427 Rattus norvegicus (Rat)
UniProt: Q531B0 Canis lupus familiaris (Dog) (Canis familiaris)
Target name NGF, NGFB, Beta-nerve growth factor, Beta-NGF
Epitope Sequence:
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRD
PNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Antibody information
Antibody name anti-NGF antibody PR-1254981
Antibody synonyms PR-1254981, Hybridoma M1130-14A9.5B12 derived
Comments inhibits NGF activity (Patent: US10093725)
Applications ELISA, Surface plasmon resonance
Cross-references Cellosaurus: CVCL_E2YR
Publications Patent: US10093725
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.