ABCD_BC341 in the ABCD (AntiBodies Chemically Defined) Database
Antigen information | |
---|---|
Target type | Protein |
Target link | UniProt: P01138 Homo sapiens (Human) UniProt: P25427 Rattus norvegicus (Rat) UniProt: Q531B0 Canis lupus familiaris (Dog) (Canis familiaris) |
Target name | NGF, NGFB, Beta-nerve growth factor, Beta-NGF |
Epitope | Sequence:SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
Antibody information | |
Antibody name | anti-NGF antibody PR-1254981 |
Antibody synonyms | PR-1254981, Hybridoma M1130-14A9.5B12 derived |
Comments | inhibits NGF activity (Patent: US10093725) |
Applications | ELISA, Surface plasmon resonance |
Cross-references | Cellosaurus: CVCL_E2YR |
Publications | Patent: US10093725 |
Would you like to obtain this antibody? | |
It can be produced at the Geneva Antibody facility (for more information, please check here).
|