ABCD_BF055 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P12449 Human immunodeficiency virus type 2 subtype A (isolate SBLISY) (HIV-2) |
| Target name | env, Envelope glycoprotein gp160, Env polyprotein |
| Epitope | gp120, Surface protein gp120, Glycoprotein 120 V3 Region Sequence:CRRPENKTVVPITLMSGRRFHSQKIINKKPRQAW Sequence:CRRPENKTVVPITLMSGRRFHSQKIINKKPRQAW |
| Antibody information | |
| Antibody name | anti-V3 7C8 |
| Antibody synonyms | Hybridoma 7C8 derived |
| Applications | Neutralization, X-ray crytallography, ELISA |
| Cross-references | PDB: 3NZ8 |
| Publications | PMID: 21541316 PMID: 18706111 PMID: 8120399 |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |