Expasy logo

ABCD

ABCD_BF496 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: P78324 Homo sapiens (Human)
Target name SIRPA, Tyrosine-protein phosphatase non-receptor type substrate 1, BIT, MFR, MYD1, PTPNS1, SHPS1, SIRP, Bit, Sirp-alpha-1, Sirp-alpha-2, Sirp-alpha-3, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MyD-1 antigen, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, p84
Epitope Sequence;ELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTT
VSDLTKRNNMDFSIRIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAK
Antibody information
Antibody name anti-SIRP-alpha Fab 25
Cross-references PDB: 7KPG
Publications PMID: 33256806
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.