ABCD_BF496 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: P78324 Homo sapiens (Human) |
| Target name | SIRPA, Tyrosine-protein phosphatase non-receptor type substrate 1, BIT, MFR, MYD1, PTPNS1, SHPS1, SIRP, Bit, Sirp-alpha-1, Sirp-alpha-2, Sirp-alpha-3, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MyD-1 antigen, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, p84 |
| Epitope | Sequence;ELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGAITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAK |
| Antibody information | |
| Antibody name | anti-SIRP-alpha Fab 25 |
| Cross-references | PDB: 7KPG |
| Publications | PMID: 33256806 |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |