ABCD_RB168 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q54U89 Dictyostelium discoideum (Social amoeba) |
| Target name | far1, grlL, Folate receptor, Folic acid receptor 1, Metabotropic glutamate receptor-like protein L, G-protein-coupled receptor (GPCR) family 3 protein 11 |
| Epitope | Sequence:SCVLIIFGAKFWKIYKPVEDDGLPQIKLKPQKSYSGSGGSGNSSGSKSKKTSAHSSTSGVKSGTSAPTQTSQSAMASINIQNFVNPIEASSRAAAQNDN |
| Antibody information | |
| Antibody name | RB168 |
| Antibody synonyms | MRB168 |
| Applications | ELISA, Western blot |
| Publications | PMID: 28076662 |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |