ABCD_RB250 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q9NZ45 Homo sapiens (Human) UniProt: Q91WS0 Mus musculus (Mouse) |
| Target name | CISD1, C10orf70, ZCD1, CDGSH iron-sulfur domain-containing protein 1, MitoNEET |
| Epitope | Sequence:KRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET |
| Antibody information | |
| Antibody name | RB250 |
| Antibody synonyms | MRB250 |
| Applications | ELISA, Immunofluorescence |
| Publications | DOI: 10.24450/journals/abrep.2018.e1 |
| Would you like to obtain this antibody? | |
| It can be produced at the Geneva Antibody facility (for more information, please check here).
| |