ABCD_RB894 in the ABCD (AntiBodies Chemically Defined) Database
| Antigen information | |
|---|---|
| Target type | Protein |
| Target link | UniProt: Q04609 Homo sapiens (Human) |
| Target name | FOLH1, FOLH, NAALAD1, PSM, PSMA, GIG27, FGCP, GCPII, mGCP, Glutamate carboxypeptidase 2, Cell growth-inhibiting gene 27 protein, Folate hydrolase 1, Folylpoly-gamma-glutamate carboxypeptidase, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, N-acetylated-alpha-linked acidic dipeptidase I, NAALADase I, Prostate-specific membrane antigen, Pteroylpoly-gamma-glutamate carboxypeptidase |
| Epitope | Sequence:LSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNE Extracellular domain |
| Antibody information | |
| Antibody name | RB894 |
| Antibody synonyms | RRB894 |
| Applications | ELISA |
| Binder Format | Nanobody |
| Interested in this antibody? | |
| Contact the Geneva Antibody Facility to assess production feasibility or check here.
| |