Expasy logo

ABCD

ABCD_RB901 in the ABCD (AntiBodies Chemically Defined) Database

Antigen information
Target type Protein
Target link UniProt: Q04609 Homo sapiens (Human)
Target name FOLH1, FOLH, NAALAD1, PSM, PSMA, GIG27, FGCP, GCPII, mGCP, Glutamate carboxypeptidase 2, Cell growth-inhibiting gene 27 protein, Folate hydrolase 1, Folylpoly-gamma-glutamate carboxypeptidase, Glutamate carboxypeptidase II, Membrane glutamate carboxypeptidase, N-acetylated-alpha-linked acidic dipeptidase I, NAALADase I, Prostate-specific membrane antigen, Pteroylpoly-gamma-glutamate carboxypeptidase
Epitope Sequence:
VLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQ
DFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDA
LFDIESKVDPSKAWGEVKRQYVAAFTVQAAAETLSEVA
Extracellular domain, C-terminal region
Antibody information
Antibody name RB901
Antibody synonyms RRB901
Comments Caution: This antibody recognizes a domain. It has not yet been validated against the full-length protein
Applications ELISA
Binder Format Nanobody
Interested in this antibody?
Contact the Geneva Antibody Facility to assess production feasibility or check here.