Sequence information
Variant position: 401 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 745 The length of the canonical sequence.
Location on the sequence:
RTEAFTIARNLLTAAADAIE
R IMSSYKEVTELAGYTARVHE
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human RTEA-------------------------------FTIARNLLTAA------------ADAIER IMSSYKEVTELAGYTARVHE
Mouse RTEA-------------------------------FTIARN
Rat RTEA-------------------------------FTIARN
Zebrafish RTQA-------------------------------FTTARS
Slime mold KKRVIFWQLGLNTTSDLFTYLSPIANYFIIAIPVFFLNNKS
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:Type: the type of sequence feature. Positions: endpoints of the sequence feature. Description: contains additional information about the feature.
Type Positions Description
Chain
1 – 745
ATP-binding cassette sub-family D member 1
Literature citations
Homo- and heterodimerization of peroxisomal ATP-binding cassette half-transporters.
Liu L.X.; Janvier K.; Berteaux-Lecellier V.; Cartier N.; Benarous R.; Aubourg P.;
J. Biol. Chem. 274:32738-32743(1999)
Cited for: SUBUNIT; CHARACTERIZATION OF VARIANTS ALD HIS-389; GLN-401; ARG-484 AND GLN-591;
Missense mutations are frequent in the gene for X-chromosomal adrenoleukodystrophy (ALD).
Fuchs S.; Sarde C.-O.; Wedemann H.; Schwinger E.; Mandel J.-L.; Gal A.;
Hum. Mol. Genet. 3:1903-1905(1994)
Cited for: VARIANTS ALD SER-148; ASP-174; ARG-266; GLN-401; TRP-418 AND PHE-515;
Identification of mutations in the ALD-gene of 20 families with adrenoleukodystrophy/adrenomyeloneuropathy.
Krasemann E.W.; Meier V.; Korenke G.C.; Hunneman D.H.; Hanefeld F.;
Hum. Genet. 97:194-197(1996)
Cited for: VARIANTS ALD PRO-107; ASP-174; MET-254; GLY-389; GLN-401; TRP-418; LYS-609; CYS-617 AND GLY-617;
Determination of 30 X-linked adrenoleukodystrophy mutations, including 15 not previously described.
Lachtermacher M.B.; Seuanez H.N.; Moser A.B.; Moser H.W.; Smith K.D.;
Hum. Mutat. 15:348-353(2000)
Cited for: VARIANTS ALD ARG-103; ARG-116; SER-152; CYS-174; TRP-189; THR-218; PRO-229; ASP-298; GLN-401; TRP-401; TRP-418; LEU-543; HIS-554; VAL-616; ARG-633 AND PRO-646;
Detection of mutations in the ALD gene (ABCD1) in seven Italian families: description of four novel mutations.
Lira M.G.; Mottes M.; Pignatti P.F.; Medica I.; Uziel G.; Cappa M.; Bertini E.; Rizzuto N.; Salviati A.;
Hum. Mutat. 16:271-271(2000)
Cited for: VARIANTS ALD GLN-401; TRP-418; LEU-543 AND ARG-556;
Molecular analysis of ABCD1 gene in Indian patients with X-linked adrenoleukodystrophy.
Shukla P.; Gupta N.; Gulati S.; Ghosh M.; Vasisht S.; Sharma R.; Gupta A.K.; Kalra V.; Kabra M.;
Clin. Chim. Acta 412:2289-2295(2011)
Cited for: VARIANTS ALD GLN-401; PRO-516; LEU-560; PRO-606 AND GLN-660;
Disclaimer:
Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.