Home  |  Contact

UniProtKB/Swiss-Prot P17050: Variant p.Glu325Lys

Alpha-N-acetylgalactosaminidase
Gene: NAGA
Variant information

Variant position:  325
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glutamate (E) to Lysine (K) at position 325 (E325K, p.Glu325Lys).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and acidic (E) to large size and basic (K)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Schindler disease (SCHIND) [MIM:609241]: Form of NAGA deficiency characterized by early-onset neuroaxonal dystrophy and neurological signs (convulsion during fever, epilepsy, psychomotor retardation and hypotonia). NAGA deficiency is typically classified in three main phenotypes: NAGA deficiency type I (Schindler disease or Schindler disease type I) with severe manifestations; NAGA deficiency type II (Kanzazi disease or Schindler disease type II) which is mild; NAGA deficiency type III (Schindler disease type III) characterized by mild-to-moderate neurologic manifestations. NAGA deficiency results in the increased urinary excretion of glycopeptides and oligosaccharides containing alpha-N-acetylgalactosaminyl moieties. Inheritance is autosomal recessive. {ECO:0000269|PubMed:2243144, ECO:0000269|PubMed:8782044}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In SCHIND; type I and type III.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  325
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  411
The length of the canonical sequence.

Location on the sequence:   INQDPLGIQGRRIHKEKSLI  E VYMRPLSNKASALVFFSCRT
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         INQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRT

Mouse                         INQDPLGIQGRRILKSKSHIEVFKRYLSNQASALVFFSRRT

Rat                           INQDPLGIQGRLIFKSKSHIEVFKRNLSDDASALVFFSRRT

Bovine                        INQDPLGIQGRRILKEKSHIEVYLRPLASEASAIVFFSRRM

Chicken                       INQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRT

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 18 – 411 Alpha-N-acetylgalactosaminidase
Modified residue 322 – 322 Phosphoserine
Modified residue 332 – 332 Phosphoserine
Beta strand 323 – 330


Literature citations

Schindler disease: the molecular lesion in the alpha-N-acetylgalactosaminidase gene that causes an infantile neuroaxonal dystrophy.
Wang A.M.; Schindler D.; Desnick R.J.;
J. Clin. Invest. 86:1752-1756(1990)
Cited for: VARIANT SCHIND LYS-325;

Human alpha-N-acetylgalactosaminidase (alpha-NAGA) deficiency: new mutations and the paradox between genotype and phenotype.
Keulemans J.L.M.; Reuser A.J.J.; Kroos M.A.; Willemsen R.; Hermans M.M.P.; van den Ouweland A.M.W.; de Jong J.G.N.; Wevers R.A.; Renier W.O.; Schindler D.; Coll M.J.; Chabas A.; Sakuraba H.; Suzuki Y.; van Diggelen O.P.;
J. Med. Genet. 33:458-464(1996)
Cited for: VARIANTS SCHIND CYS-160 AND LYS-325;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.