UniProtKB/Swiss-Prot P20020: Variant p.Met267Arg

Plasma membrane calcium-transporting ATPase 1
Gene: ATP2B1
Feedback?

Variant information Variant position:

267 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Methionine (M) to Arginine (R) at position 267 (M267R, p.Met267Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from medium size and hydrophobic (M) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

-1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page

Sequence information Variant position:

267 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

1220 The length of the canonical sequence.
Location on the sequence:

SDHVKKSLDKDPLLLSGTHV M EGSGRMVVTAVGVNSQTGII The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGII

Mouse                         SDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGII

Rat                           SDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGII

Pig                           SDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGINSQTGII

Rabbit                        SDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGII

Chicken                       SDHVKKSLDRDPMLLSGTHVMEGSGRMVVTAVGVNSQTGII

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	2 – 1220	Plasma membrane calcium-transporting ATPase 1
Topological domain	176 – 366	Cytoplasmic

Literature citations
Investigation of the Met-267 Arg exchange in isoform 1 of the human plasma membrane calcium pump in patients with essential hypertension by the amplification-created restriction site technique.
Benkwitz C.; Kubsisch C.; Kraft K.; Neyses L.;
J. Mol. Med. 75:62-66(1997)
Cited for: VARIANT ARG-267;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.