Variant position:  977

Type of variant:  LP/P [Disclaimer: Variants classification is intended for research purposes only, not for clinical and diagnostic use. The label disease variant is assigned according to literature reports on probable disease-association that can be based on theoretical reasons. This label must not be considered as a definitive proof for the pathogenic role of a variant.]

Residue change:  From Threonine (T) to Methionine (M) at position 977 (T977M, p.Thr977Met).

Physico-chemical properties:  Change from medium size and polar (T) to medium size and hydrophobic (M)

BLOSUM score:  -1

Variant description:  In WD; loss of copper transport activity.

Other resources:  

• Variant rs72552255 [ dbSNP | Ensembl ]

Variant position:  977

Protein sequence length:  1465

Location on the sequence:   PNKHISQTEVIIRFAFQTSI  T VLCIACPCSLGLATPTAVMV

Residue conservation: 

Human                         PNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMV

Mouse                         PSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMV

Rat                           PSKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMV

Sheep                         PSKGISQAEVVLRFAFQTSITVLCIACPCSLGLATPTAVMV

Sequence annotation in neighborhood:  

Functional characterization of missense mutations in ATP7B: Wilson disease mutation or normal variant?
Forbes J.R.; Cox D.W.;
Am. J. Hum. Genet. 63:1663-1674(1998)
Cited for: CHARACTERIZATION OF VARIANTS WD ASN-765; VAL-769; VAL-776; LEU-778; GLN-778; SER-943; MET-977 AND LEU-992; CHARACTERIZATION OF VARIANT ALA-995;

Twenty-four novel mutations in Wilson disease patients of predominantly Italian origin.
Lepori M.B.; Lovicu M.; Dessi V.; Zappu A.; Incollu S.; Zancan L.; Giacchino R.; Iorio R.; Vajro P.; Maggiore G.; Marcellini M.; Barbera C.; Pellecchia M.T.; Simonetti R.; Kostic V.; Farci A.M.; Solinas A.; De Virgiliis S.; Cao A.; Loudianos G.;
Genet. Test. 11:328-332(2007)
Cited for: VARIANTS WD ARG-645; VAL-769; GLN-778; TRP-778; PRO-827; ALA-858; VAL-874; PHE-899; TRP-919; MET-935; TRP-969; MET-977; VAL-982; MET-991; ARG-1012; VAL-1012; VAL-1018; LYS-1064; SER-1099; CYS-1151; MET-1220; MET-1288; PRO-1322; LYS-1332; ASP-1341 AND LEU-1369;

Distinct clinical courses according to presenting phenotypes and their correlations to ATP7B mutations in a large Wilson's disease cohort.
Lee B.H.; Kim J.H.; Lee S.Y.; Jin H.Y.; Kim K.J.; Lee J.J.; Park J.Y.; Kim G.H.; Choi J.H.; Kim K.M.; Yoo H.W.;
Liver Int. 31:831-839(2011)
Cited for: VARIANTS WD ARG-108; VAL-729; GLN-778; LEU-778; TRP-827; VAL-874; ASP-891; 899-ILE--GLN-907 DEL; GLY-919; ASP-943; SER-943; GLN-969; MET-977; LEU-992; THR-1010; ALA-1024; ILE-1029; ALA-1031; VAL-1035; PHE-1083; TYR-1091; ILE-1106; THR-1148; CYS-1151; SER-1168; SER-1186; MET-1216; ALA-1267; SER-1270; LEU-1273 AND ASP-1295; CHARACTERIZATION OF VARIANTS WD TRP-827; THR-1010; CYS-1151 AND ASP-1295;

A genetic study of Wilson's disease in the United Kingdom.
Coffey A.J.; Durkie M.; Hague S.; McLay K.; Emmerson J.; Lo C.; Klaffke S.; Joyce C.J.; Dhawan A.; Hadzic N.; Mieli-Vergani G.; Kirk R.; Elizabeth Allen K.; Nicholl D.; Wong S.; Griffiths W.; Smithson S.; Giffin N.; Taha A.; Connolly S.; Gillett G.T.; Tanner S.; Bonham J.; Sharrack B.; Palotie A.; Rattray M.; Dalton A.; Bandmann O.;
Brain 136:1476-1487(2013)
Cited for: VARIANTS WD TRP-136; TRP-148; CYS-382; ALA-536; LYS-541; ILE-597; CYS-614; SER-641; ARG-645; ILE-665; ALA-731; PRO-745; VAL-769; TRP-778; ARG-869; TRP-919; VAL-936; MET-977; MET-991; ALA-995; ILE-1017; VAL-1021; TRP-1041; VAL-1058; GLN-1069; SER-1070; VAL-1074; GLY-1250; ARG-1266; SER-1270; ILE-1298; LEU-1298; TYR-1431 AND PHE-1432;

Efficient detection of mutations in Wilson disease by manifold sequencing.
Waldenstroem E.; Lagerkvist A.; Dahlman T.; Westermark K.; Landegren U.;
Genomics 37:303-309(1996)
Cited for: VARIANTS WD PHE-967; MET-977; ASP-1106; ARG-1153 AND SER-1355;

Mutation analysis of Wilson disease in the Spanish population -identification of a prevalent substitution and eight novel mutations in the ATP7B gene.
Margarit E.; Bach V.; Gomez D.; Bruguera M.; Jara P.; Queralt R.; Ballesta F.;
Clin. Genet. 68:61-68(2005)
Cited for: VARIANTS WD ARG-645; LEU-690; ARG-869; SER-943; MET-977; GLU-1061; GLN-1069; SER-1099; MET-1216 AND PRO-1232; VARIANTS ALA-406; LEU-456; ARG-832 AND ALA-1140;

Frameshift and nonsense mutations in the gene for ATPase7B are associated with severe impairment of copper metabolism and with an early clinical manifestation of Wilson's disease.
Gromadzka G.; Schmidt H.H.-J.; Genschel J.; Bochow B.; Rodo M.; Tarnacka B.; Litwin T.; Chabik G.; Czlonkowska A.;
Clin. Genet. 68:524-532(2005)
Cited for: VARIANTS WD GLN-616; TYR-639; TYR-653; PRO-776; GLY-778; MET-977; ARG-988; LEU-992; GLN-1069; PRO-1095; MET-1220; LEU-1273 AND ASP-1341;

Mutation analysis of the ATP7B gene and genotype/phenotype correlation in 227 patients with Wilson disease.
Vrabelova S.; Letocha O.; Borsky M.; Kozak L.;
Mol. Genet. Metab. 86:277-285(2005)
Cited for: VARIANTS WD SER-641; SER-710; ARG-737; GLY-778; GLU-918; GLN-969; MET-977; VAL-1018; SER-1033; TRP-1041; VAL-1063; LYS-1064; GLN-1069; THR-1102; ASP-1111; THR-1148; ARG-1176; SER-1186; ASN-1271; LEU-1273; PRO-1305; ASP-1341 AND CYS-1355; VARIANTS LEU-456; ARG-832 AND ALA-1140;

Phenotypic and genetic characterization of a cohort of pediatric Wilson disease patients.
Abdel Ghaffar T.Y.; Elsayed S.M.; Elnaghy S.; Shadeed A.; Elsobky E.S.; Schmidt H.;
BMC Pediatr. 11:56-56(2011)
Cited for: VARIANTS WD PRO-549; HIS-642; TYR-703; PRO-744; ASN-765; GLY-778; MET-977; ASP-998; VAL-1063; GLN-1069; ARG-1207; LEU-1273; ASP-1332; ARG-1341 AND ASP-1341;