Home  |  Contact

UniProtKB/Swiss-Prot P00915: Variant p.His68Arg

Carbonic anhydrase 1
Gene: CA1
Variant information

Variant position:  68
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Histidine (H) to Arginine (R) at position 68 (H68R, p.His68Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (H) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In variant Michigan-1; confers enhanced esterase activity and an additional zinc binding site.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  68
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  261
The length of the canonical sequence.

Location on the sequence:   ISVSYNPATAKEIINVGHSF  H VNFEDNDNRSVLKGGPFSDS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         ISVS---------------------------------------YNPATAK----------------------EIINVGHSFHVNFEDNDNRSVLKG--GPFSD-S

Gorilla                       ISVS-------------------------------------

Rhesus macaque                ISVS-------------------------------------

Chimpanzee                    ISVS-------------------------------------

Mouse                         LSIS-------------------------------------

Rat                           VSVS-------------------------------------

Bovine                        LSVS-------------------------------------

Sheep                         LSIS-------------------------------------

Horse                         FSVS-------------------------------------

Caenorhabditis elegans        VSYAELNFFLIIYLTISLKLMRYIFTCAHLFACNKKLGTWN

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 261 Carbonic anhydrase 1
Domain 4 – 261 Alpha-carbonic anhydrase
Active site 65 – 65 Proton acceptor
Metal binding 65 – 65 Zinc 2; in variant Michigan-1
Metal binding 68 – 68 Zinc 2; in variant Michigan-1
Beta strand 64 – 71


Literature citations

Crystal structure of a zinc-activated variant of human carbonic anhydrase I, CA I Michigan 1: evidence for a second zinc binding site involving arginine coordination.
Ferraroni M.; Tilli S.; Briganti F.; Chegwidden W.R.; Supuran C.T.; Wiebauer K.E.; Tashian R.E.; Scozzafava A.;
Biochemistry 41:6237-6244(2002)
Cited for: X-RAY CRYSTALLOGRAPHY (2.00 ANGSTROMS) OF 2-260 IN COMPLEX WITH ZINC ION; VARIANT MICHIGAN-1 ARG-68;

Marked zinc activation of ester hydrolysis by a mutation, 67-His (CAT) to Arg (CGT), in the active site of human carbonic anhydrase I.
Chegwidden W.R.; Wagner L.E.; Venta P.J.; Bergenhem N.C.H.; Yu Y.-S.L.; Tashian R.E.;
Hum. Mutat. 4:294-296(1994)
Cited for: VARIANT MICHIGAN-1 ARG-68;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.