Expasy logo

UniProtKB/Swiss-Prot variant pages

Due to maintenance work, this service will be unavailable on Monday between 06:00 until 06:30 CEST. Apologies for the inconvenience.

UniProtKB/Swiss-Prot P21359: Variant p.Arg1611Trp

Neurofibromin
Gene: NF1
Feedback?
Variant information Variant position: help 1611 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 1611 (R1611W, p.Arg1611Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In NF1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1611 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 2839 The length of the canonical sequence.
Location on the sequence: help SIFYQAGTSKAGNPIFYYVA R RFKTGQINGDLLIYHVLLTL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         SIFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTL

Mouse                         SIFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTL

Rat                           SIFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 2839 Neurofibromin
Domain 1580 – 1738 CRAL-TRIO
Region 1580 – 1837 Lipid binding
Alternative sequence 552 – 2839 Missing. In isoform 3.
Alternative sequence 594 – 2839 Missing. In isoform 5.
Alternative sequence 1599 – 2839 Missing. In isoform 4.
Helix 1610 – 1612



Literature citations
Six novel mutations in the neurofibromatosis type 1 (NF1) gene.
Upadhyaya M.; Maynard J.; Osborn M.J.; Harper P.S.;
Hum. Mutat. 10:248-250(1997)
Cited for: VARIANTS NF1 GLY-338 AND TRP-1611;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.