Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P48357: Variant p.Lys656Asn

Leptin receptor
Gene: LEPR
Feedback?
Variant information Variant position: help 656 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Lysine (K) to Asparagine (N) at position 656 (K656N, p.Lys656Asn). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (K) to medium size and polar (N) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 656 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1165 The length of the canonical sequence.
Location on the sequence: help IKVPMRGPEFWRIINGDTMK K EKNVTLLWKPLMKNDSLCSV The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         IKVPMRGPEFWRIINGDTMKKEKNVTLLWKPLMKNDSLCSV

Rhesus macaque                IKVPMRGPEFWRIINGDTMKKEKNVTLLWKPLMKNESLCSV

Mouse                         VKVPMRGPEFWRKMDGDVTKKERNVTLLWKPLTKNDSLCSV

Rat                           VKVPMRGPEFWRIMDGDITKKERNVTLLWKPLMKNDSLCSV

Pig                           VKVPIRGPEFWRIINEDATKKERNITLLWKPLMKNDSLCSV

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 22 – 1165 Leptin receptor
Topological domain 22 – 839 Extracellular
Domain 639 – 732 Fibronectin type-III 3
Glycosylation 659 – 659 N-linked (GlcNAc...) asparagine



Literature citations
Amino acid variants in the human leptin receptor: lack of association to juvenile onset obesity.
Echwald S.M.; Soerensen T.D.; Soerensen T.I.; Tybjaerg-Hansen A.; Andersen T.; Chung W.K.; Leibel R.L.; Pedersen O.;
Biochem. Biophys. Res. Commun. 233:248-252(1997)
Cited for: VARIANTS ARG-109; ARG-204; ARG-223 AND ASN-656;
Exonic and intronic sequence variation in the human leptin receptor gene (LEPR).
Chung W.K.; Power-Kehoe L.; Chua M.; Chu F.; Aronne L.; Huma Z.; Sothern M.; Udall J.N.; Kahle B.; Leibel R.L.;
Diabetes 46:1509-1511(1997)
Cited for: VARIANTS ARG-109; ARG-223 AND ASN-656;
Leptin receptor gene variation and obesity: lack of association in a white British male population.
Gotoda T.; Manning B.S.; Goldstone A.P.; Imrie H.; Evans A.L.; Strosberg A.D.; McKeigue P.M.; Scott J.; Aitman T.J.;
Hum. Mol. Genet. 6:869-876(1997)
Cited for: VARIANTS ARG-109; ARG-223 AND ASN-656;
Transmission disequilibrium and sequence variants at the leptin receptor gene in extremely obese German children and adolescents.
Roth H.; Korn T.; Rosenkranz K.; Hinney A.; Ziegler A.; Kunz J.; Siegfried W.; Mayer H.; Hebebrand J.; Grzeschik K.-H.;
Hum. Genet. 103:540-546(1998)
Cited for: VARIANTS ARG-109; ARG-223; ASN-656 AND THR-675;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.