UniProtKB/Swiss-Prot P35475: Variant p.Arg105Gln

Alpha-L-iduronidase
Gene: IDUA
Feedback?

Variant information Variant position:

105 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Arginine (R) to Glutamine (Q) at position 105 (R105Q, p.Arg105Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources:

Links to websites of interest for the variant.

Variant rs3755955 [ dbSNP | Ensembl ]

Sequence information Variant position:

105 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

653 The length of the canonical sequence.
Location on the sequence:

IKQVRTHWLLELVTTRGSTG R GLSYNFTHLDGYLDLLRENQ The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         IKQVRTHWLLELVTTRGSTGRGL-SYNFTHLDGYLDLLREN-Q

                              IEQVRTHWLLELITARESAGQGL-SYNFTHLDGYLDLLREN

Mouse                         IEQVRIHWLLDLITARKSPGQGL-MYNFTHLDAFLDLLMEN

Drosophila                    VTHIRIHWLLELIQFWQYDPSGIPIYDFSKFDDFIDFLHEE

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	28 – 653	Alpha-L-iduronidase
Binding site	91 – 91
Glycosylation	110 – 110	N-linked (GlcNAc...) asparagine
Turn	103 – 105

Literature citations
Identification and molecular characterization of alpha-L-iduronidase mutations present in mucopolysaccharidosis type I patients undergoing enzyme replacement therapy.
Yogalingam G.; Guo X.H.; Muller V.J.; Brooks D.A.; Clements P.R.; Kakkis E.D.; Hopwood J.J.;
Hum. Mutat. 24:199-207(2004)
Cited for: VARIANTS MPS1H/S VAL-79; GLN-238; PRO-327; CYS-363; ARG-380; ARG-533 AND ILE-602; VARIANT MPS1S ARG-423; VARIANTS GLN-82; GLN-105; THR-361 AND ILE-454; CHARACTERIZATION OF VARIANTS MPS1H/S VAL-79; GLN-238; CYS-363 AND ILE-602; CHARACTERIZATION OF VARIANT MPS1S ARG-423; CHARACTERIZATION OF VARIANT GLN-82; Mucopolysaccharidosis type I in 21 Czech and Slovak patients: mutation analysis suggests a functional importance of C-terminus of the IDUA protein.
Vazna A.; Beesley C.; Berna L.; Stolnaja L.; Myskova H.; Bouckova M.; Vlaskova H.; Poupetova H.; Zeman J.; Magner M.; Hlavata A.; Winchester B.; Hrebicek M.; Dvorakova L.;
Am. J. Med. Genet. A 149A:965-974(2009)
Cited for: VARIANTS MPS1H TYR-315; PRO-327 AND PHE-620; CHARACTERIZATION OF VARIANTS MPS1H TYR-315 AND PHE-620; VARIANT MPS1S ARG-380; VARIANTS GLN-33; GLN-105; THR-361 AND ILE-454; IDUA mutational profiling of a cohort of 102 European patients with mucopolysaccharidosis type I: identification and characterization of 35 novel alpha-L-iduronidase (IDUA) alleles.
Bertola F.; Filocamo M.; Casati G.; Mort M.; Rosano C.; Tylki-Szymanska A.; Tuysuz B.; Gabrielli O.; Grossi S.; Scarpa M.; Parenti G.; Antuzzi D.; Dalmau J.; Di Rocco M.; Vici C.D.; Okur I.; Rosell J.; Rovelli A.; Furlan F.; Rigoldi M.; Biondi A.; Cooper D.N.; Parini R.;
Hum. Mutat. 32:E2189-E2210(2011)
Cited for: VARIANTS MPS1H/S ARG-84; LYS-178; LEU-188; ARG-265; LYS-276; PRO-396; ARG-423; PRO-436; ARG-496; ARG-533 AND PHE-535; VARIANTS MPS1H ASP-51; PRO-103; PRO-327 AND ARG-385; VARIANTS MPS1S CYS-76; TRP-89; GLU-219; LYS-276; LEU-306; LYS-348; PRO-490 AND PRO-492; VARIANTS GLN-33; GLN-105; THR-361; ASN-449; ILE-454 AND THR-591;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.