UniProtKB/Swiss-Prot P16442: Variant p.Gly268Ala

Histo-blood group ABO system transferase
Gene: ABO
Feedback?

Variant information Variant position:

268 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant:

LB/B The variants are classified into three categories: LP/P, LB/B and US.

LP/P: likely pathogenic or pathogenic.
LB/B: likely benign or benign.
US: uncertain significance

Residue change:

From Glycine (G) to Alanine (A) at position 268 (G268A, p.Gly268Ala). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties:

Change from glycine (G) to small size and hydrophobic (A) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score:

0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

Lowest score: -4 (low probability of substitution).
Highest score: 11 (high probability of substitution).

More information can be found on the following page
Polymorphism:

Genetic variations in ABO define the ABO blood group system [MIM:616093]. The ABO blood group system is one of the most important blood group systems in transfusion medicine. The ABO blood group involves 3 carbohydrate antigens: A, B, and H. A, B, and AB individuals express a glycosyltransferase activity that converts the H antigen to the A antigen (by addition of UDP-GalNAc) or to the B antigen (by addition of UDP-Gal). There are only 4 amino acid differences between A and B transferases in the catalytic domain, two of which (Leu266Met and Gly268Ala) are primarily responsible for the substrate specificity. The group O phenotype results from variations in ABO that cause a loss of glycosyltransferase activity. The most common group O allele results from a single nucleotide deletion near the 5' end of the gene (NM_020469.2:c.261del) that causes a frameshift and early termination with no active enzyme production (p.Thr88Profs*31). Additional information on the polymorphism described.
Variant description:

In allele Bw08. Any additional useful information about the variant.
Other resources:

Links to websites of interest for the variant.

Variant rs8176747 [ dbSNP | Ensembl ]

Sequence information Variant position:

268 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length:

354 The length of the canonical sequence.
Location on the sequence:

RRPQSQAYIPKDEGDFYYLG G FFGGSVQEVQRLTRACHQAM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation:

The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         RRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAM

Mouse                         RRPQSQAYIPWDRGDFYYGGAFFGGSVLEVYHLTKACHEAM

Sequence annotation in neighborhood:

The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

Type: the type of sequence feature.
Positions: endpoints of the sequence feature.
Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 354	Histo-blood group ABO system transferase
Chain	54 – 354	Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase soluble form
Topological domain	54 – 354	Lumenal

Literature citations
Aberrant intracellular trafficking of a variant B glycosyltransferase.
Seltsam A.; Gruger D.; Just B.; Figueiredo C.; Gupta C.D.; Deluca D.S.; Blasczyk R.;
Transfusion 48:1898-1905(2008)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; POLYMORPHISM; VARIANTS ARG-230; SER-235; MET-266 AND ALA-268; SUBCELLULAR LOCATION; CHARACTERIZATION OF VARIANT ARG-230; Submission
SeattleSNPs variation discovery resource;
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]; POLYMORPHISM; VARIANTS ARG-35; PHE-36; HIS-63; SER-74; LEU-156; HIS-161; GLY-176; CYS-199; ILE-216; SER-235; MET-266; ALA-268 AND MET-277; The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
The MGC Project Team;
Genome Res. 14:2121-2127(2004)
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]; POLYMORPHISM; VARIANTS GLY-176; SER-235; MET-266 AND ALA-268; The nature of diversity and diversification at the ABO locus.
Seltsam A.; Hallensleben M.; Kollmann A.; Blasczyk R.;
Blood 102:3035-3042(2003)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 11-354; POLYMORPHISM; VARIANTS SER-74; LEU-156; MET-163; GLY-176; TRP-198; SER-235; MET-266; ALA-268; ARG-268; ARG-288 AND MET-346; Molecular genetic analysis of variant phenotypes of the ABO blood group system.
Ogasawara K.; Yabe R.; Uchikawa M.; Saitou N.; Bannai M.; Nakata K.; Takenaka M.; Fujisawa K.; Ishikawa Y.; Juji T.; Tokunaga K.;
Blood 88:2732-2737(1996)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 81-354; POLYMORPHISM; VARIANTS LEU-156; GLY-176; ARG-214; ILE-216; ASP-223; SER-235; MET-266; ALA-268; MET-277; ASN-291; GLY-352 AND TRP-352; Evolution of the O alleles of the human ABO blood group gene.
Roubinet F.; Despiau S.; Calafell F.; Jin F.; Bertanpetit J.; Saitou N.; Blancher A.;
Transfusion 44:707-715(2004)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 11-354; POLYMORPHISM; VARIANTS GLY-176; SER-235; MET-266 AND ALA-268; Animal histo-blood group ABO genes.
Kominato Y.; McNeill P.D.; Yamamoto M.; Russell M.; Hakomori S.; Yamamoto F.;
Biochem. Biophys. Res. Commun. 189:154-164(1992)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 146-334; POLYMORPHISM; VARIANTS MET-266 AND ALA-268;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.