Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P16473: Variant p.Asp619Gly

Thyrotropin receptor
Gene: TSHR
Feedback?
Variant information Variant position: help 619 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help US The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Aspartate (D) to Glycine (G) at position 619 (D619G, p.Asp619Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and acidic (D) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In hyperthyroidism; found in toxic thyroid nodules and hyperfunctioning thyroid adenomas. Any additional useful information about the variant.


Sequence information Variant position: help 619 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 764 The length of the canonical sequence.
Location on the sequence: help CCYVKIYITVRNPQYNPGDK D TKIAKRMAVLIFTDFICMAP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         CCYVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFICMAP

                              SCYVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFMCMAP

Mouse                         SCYVKIYITVRNPQYNPRDKDTKIAKRMAVLIFTDFMCMAP

Rat                           SCYVKIYITVRNPQYNPRDKDTKIAKRMAVLIFTDFMCMAP

Pig                           SCYVKIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFMCMAP

Bovine                        ACYVKIYITVRNPHYNPGDKDTRIAKRMAVLIFTDFMCMAP

Sheep                         ACYVKIYITVRNPHYNPGDKDTRIAKRMAVLIFTDFMCMAP

Cat                           SCYVKIYITVRNPQYNTGDKDTKIAKRMAVLIFTDFMCMAP

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 21 – 764 Thyrotropin receptor
Topological domain 603 – 625 Cytoplasmic
Alternative sequence 254 – 764 Missing. In isoform Short.
Alternative sequence 275 – 764 Missing. In isoform 3.
Helix 618 – 648



Literature citations
Somatic mutations in the thyrotropin receptor gene cause hyperfunctioning thyroid adenomas.
Parma J.; Duprez L.; van Sande J.; Cochaux P.; Gervy C.; Mockel J.; Dumont J.E.; Vassart G.;
Nature 365:649-651(1993)
Cited for: VARIANTS HYPERTHYROIDISM GLY-619 AND ILE-623; Diversity and prevalence of somatic mutations in the thyrotropin receptor and Gs alpha genes as a cause of toxic thyroid adenomas.
Parma J.; Duprez L.; van Sande J.; Hermans J.; Rocmans P.; van Vliet G.; Costagliola S.; Rodien P.; Dumont J.E.; Vassart G.;
J. Clin. Endocrinol. Metab. 82:2695-2701(1997)
Cited for: VARIANTS HYPERTHYROIDISM ASN-281; THR-281; THR-453; PHE-486; MET-486; THR-568; GLY-619; ILE-623; PHE-629; LEU-630; LEU-631; ILE-632; ALA-633; GLU-633; HIS-633; TYR-633 AND 658-ASN--ILE-661 DEL; Detection of thyroid-stimulating hormone receptor and G(s)alpha mutations: in 75 toxic thyroid nodules by denaturing gradient gel electrophoresis.
Truelzsch B.; Krohn K.; Wonerow P.; Chey S.; Holzapfel H.-P.; Ackermann F.; Fuehrer D.; Paschke R.;
J. Mol. Med. 78:684-691(2001)
Cited for: VARIANTS ASN-281; ILE-425; THR-453; PHE-486; ASN-505; ARG-512; GLN-512; THR-568; GLY-619; VAL-623; LEU-631; ALA-632; ILE-632; GLU-633; HIS-633; TYR-633; ALA-639 AND PHE-656; CHARACTERIZATION OF VARIANTS ILE-425 AND GLN-512;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.