Home  |  Contact

UniProtKB/Swiss-Prot P48637: Variant p.Gly464Val

Glutathione synthetase
Gene: GSS
Variant information

Variant position:  464
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glycine (G) to Valine (V) at position 464 (G464V, p.Gly464Val).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to medium size and hydrophobic (V)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -3
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Glutathione synthetase deficiency (GSS deficiency) [MIM:266130]: Severe form characterized by an increased rate of hemolysis and defective function of the central nervous system. {ECO:0000269|PubMed:27581854, ECO:0000269|PubMed:8896573, ECO:0000269|PubMed:9215686}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In GSS deficiency.
Any additional useful information about the variant.



Sequence information

Variant position:  464
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  474
The length of the canonical sequence.

Location on the sequence:   HVGHLLRTKAIEHADGGVAA  G VAVLDNPYPV
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         HVGHLLRTKAIEHADGGVAAGVAVLDNPYPV-

Mouse                         HVGHLLRTKAVEHADGGVAAGVAVLDNPYPV

Rat                           HVGHLLRTKAIEHADGGVAAGVAVLDNPYPV

Bovine                        HVGHLLRTKAIEHADGGVAAGVAVLDNPYPV

Xenopus laevis                QVGHLLRTKAIEHSDGGVAAGVAVLDNPYLV

Slime mold                    QAGILLRTKTANSDEVGVAAGFGLLDSPILE

Baker's yeast                 FSGSLLRSKFNTSNEGGVAAGFGCLDSIILY

Fission yeast                 QSGFICRTKPKKTNEGGVATGYASLSSIELS

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 474 Glutathione synthetase
Binding site 450 – 450 Substrate
Binding site 452 – 452 ATP
Binding site 458 – 458 ATP; via carbonyl oxygen
Turn 461 – 464


Literature citations

No reference for the current variant in UniProtKB/Swiss-Prot.

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.