Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q05066: Variant p.Arg62Gly

Sex-determining region Y protein
Gene: SRY
Feedback?
Variant information Variant position: help 62 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Glycine (G) at position 62 (R62G, p.Arg62Gly). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to glycine (G) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In SRXY1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 62 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 204 The length of the canonical sequence.
Location on the sequence: help SKYQCETGENSKGNVQDRVK R PMNAFIVWSRDQRRKMALEN The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         SKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALEN

Gorilla                       SKYQCETGENSKGSVQDRVKRPMNAFIVWSRDQRRKMALEN

                              SNYRCESGGNGRDSGRNRVRRPMNAFLVWSRDQRRKMALEN

Rhesus macaque                SKYQCEAGENSKGSVQDKVKRPMNAFIVWSRDQKRKMALEN

Chimpanzee                    SKYQRETGENSKDSVQDRVKRPMNAFFVWSRDQRRKMALEN

Mouse                         --------------MEGHVKRPMNAFMVWSRGERHKLAQQN

Rat                           --------------MEGHVKRPMNAFMVWSRGERRKLAQQN

Pig                           SNDGRETRGSGRESGQDRVKRPMNAFIVWSRDQRRKVALEN

Bovine                        ANDQCERGEHVRESSQDHVKRPMNAFIVWSRERRRKVALEN

Goat                          ANDQCERGENVTESSQDHVKRPMNAFIVWSRERRRKVALEN

Sheep                         ANDQRERGENVRESSQNHVKRPMNAFIVWSRERRRKVALEN

Cat                           SNYRCETRGKGRDRGQDRVKRPMNAFMVWSRDQRRKVALEN

Horse                         SHFRSETRGNGRENGQDRVKRPMNAFMVWSRDHRRKVALEN

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 204 Sex-determining region Y protein
DNA binding 60 – 128 HMG box
Region 59 – 136 Sufficient for interaction with KPNB1
Region 61 – 77 Required for nuclear localization
Mutagenesis 62 – 62 R -> G. Strongly reduces nuclear localization. Strongly reduces nuclear localization; when associated with W-133. Reduces interaction with KPNB1.
Mutagenesis 75 – 75 R -> N. Strongly reduces nuclear localization. Abolishes DNA-binding. Does not reduce interaction with KPNB1 and CAML.
Mutagenesis 76 – 76 R -> P. Reduces nuclear localization. Reduces DNA-binding. Does not reduce interaction with KPNB1 and CAML. Does not affectnuclear import.
Helix 60 – 64



Literature citations
Analysis of the SRY gene in 22 sex-reversed XY females identifies four new point mutations in the conserved DNA binding domain.
Affara N.A.; Chalmers I.J.; Ferguson-Smith M.A.;
Hum. Mol. Genet. 2:785-789(1993)
Cited for: VARIANTS SRXY1 GLY-62; THR-78 AND TRP-133;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.