Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P28069: Variant p.Arg143Gln

Pituitary-specific positive transcription factor 1
Gene: POU1F1
Feedback?
Variant information Variant position: help 143 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Arginine (R) to Glutamine (Q) at position 143 (R143Q, p.Arg143Gln). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to medium size and polar (Q) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In CPHD1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 143 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 291 The length of the canonical sequence.
Location on the sequence: help DMDSPEIRELEKFANEFKVR R IKLGYTQTNVGEALAAVHGS The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         DMDSPEIRELEKFANEFKVR-----------------------------------------------------RIKLGY--TQTNVGEALAAVHGS

                              DTESPEIRELEKFANEFKVR---------------------

Rhesus macaque                DMDSPEIRELEKFANEFKVR---------------------

Mouse                         DMDSPEIRELEQFANEFKVR---------------------

Rat                           DMDSPEIRELEQFANEFKVR---------------------

Pig                           DMDSPEIRELEKFPNEFKVR---------------------

Bovine                        DMDSPEIRELEKFANEFKVR---------------------

Sheep                         DMDSPEIRELEKFANEFKVR---------------------

Chicken                       DMDSPEIRELEKFANEFKLR---------------------

Fission yeast                 GISLPKMAPLD-FGDLFSPPWNLAFASMLSQLLKWDPAKRP
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 291 Pituitary-specific positive transcription factor 1
Domain 124 – 198 POU-specific
Helix 127 – 145



Literature citations
Mutations in the Pit-1 gene in children with combined pituitary hormone deficiency.
Ohta K.; Nobukuni Y.; Mitsubuchi H.; Fujimoto S.; Matsuo N.; Inagaki H.; Endo F.; Matsuda I.;
Biochem. Biophys. Res. Commun. 189:851-855(1992)
Cited for: VARIANTS CPHD1 LEU-24; GLN-143 AND TRP-271;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.