Home  |  Contact

UniProtKB/Swiss-Prot P01871: Variant p.Gly191Ser

Immunoglobulin heavy constant mu
Gene: IGHM
Variant information

Variant position:  191
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LB/B
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Glycine (G) to Serine (S) at position 191 (G191S, p.Gly191Ser).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from glycine (G) to small size and polar (S)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism:  There are several alleles. The sequence shown is that of IMGT allele IGHM*04.
Additional information on the polymorphism described.

Variant description:  In IMGT allele IGHM*03.
Any additional useful information about the variant.



Sequence information

Variant position:  191
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  453
The length of the canonical sequence.

Location on the sequence:   SGPTTYKVTSTLTIKESDWL  G QSMFTCRVDHRGLTFQQNAS
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNA--S

                              SGPTTYKVTSMLTIQEDAWLSQSVFTCKVEHRGLTFQQNA-

Mouse                         STPQTYKVISTLTISEIDWLNLNVYTCRVDHRGLTFLKNV-

Rabbit                        AGPATFSISSMLTITESDWLSQSLYTCRVDHRGIFFDKNVS

Chicken                       VGPEVV-AESRISVTESEWDTGATFSCVVEGE----MRNTS

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 453 Immunoglobulin heavy constant mu
Domain 111 – 211 Ig-like 2
Region 106 – 217 CH2
Glycosylation 209 – 209 N-linked (GlcNAc...) (complex) asparagine
Disulfide bond 134 – 197


Literature citations

Complete nucleotide sequence of the membrane form of the human IgM heavy chain.
Friedlander R.M.; Nussenzweig M.C.; Leder P.;
Nucleic Acids Res. 18:4278-4278(1990)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2); VARIANT SER-191;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.