Home  |  Contact

UniProtKB/Swiss-Prot Q14773: Variant p.Gln100Arg

Intercellular adhesion molecule 4
Gene: ICAM4
Variant information

Variant position:  100
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Polymorphism
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Glutamine (Q) to Arginine (R) at position 100 (Q100R, p.Gln100Arg).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (Q) to large size and basic (R)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Polymorphism:  Responsible for the Landsteiner-Wiener blood group system [MIM:111250]. The molecular basis of the LW(A)=LW5/LW(B)=LW7 blood group antigens is a single variation in position 100; Gln-100 corresponds to LW(A) and Arg-100 to LW(B).
Additional information on the polymorphism described.

Variant description:  In LW(B).
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  100
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  271
The length of the canonical sequence.

Location on the sequence:   SLRTPLRQGKTLRGPGWVSY  Q LLDVRAWSSLAHCLVTCAGK
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGK

Mouse                         SLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGE

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 23 – 271 Intercellular adhesion molecule 4
Topological domain 23 – 240 Extracellular
Domain 62 – 124 Ig-like C2-type 1
Disulfide bond 69 – 117
Disulfide bond 69 – 113
Disulfide bond 73 – 117


Literature citations

Molecular basis and expression of the LWa/LWb blood group polymorphism.
Hermand P.; Gane P.; Mattei M.-G.; Sistonen P.; Cartron J.-P.; Bailly P.;
Blood 86:1590-1594(1995)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-130; VARIANT BLOOD GROUP LW(B) ARG-100;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.