Home  |  Contact

UniProtKB/Swiss-Prot P32004: Variant p.Ile219Thr

Neural cell adhesion molecule L1
Gene: L1CAM
Variant information

Variant position:  219
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Isoleucine (I) to Threonine (T) at position 219 (I219T, p.Ile219Thr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and hydrophobic (I) to medium size and polar (T)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  -1
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In HSAS; decrease in cell-matrix adhesion; decreased cell migration; no effect on the localization at the cell surface; no effect on cell proliferation, when transfected in pheochromocytoma PC12 cells; no effect on neurite outgrowth, when assayed in NGF-treated pheochromocytoma PC12 cells.
Any additional useful information about the variant.



Sequence information

Variant position:  219
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1257
The length of the canonical sequence.

Location on the sequence:   LTSDNHSDYICHAHFPGTRT  I IQKEPIDLRVKATNSMIDRK
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRK

Mouse                         LTSDNHSDYICNAHFPGTRTIIQKEPIDLRVKPTNSMIDRK

Rat                           LTSDNHSDYICNAHFPGTRTIIQKEPIDLRVKPTNSMIDRK

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 20 – 1257 Neural cell adhesion molecule L1
Topological domain 20 – 1120 Extracellular
Domain 139 – 226 Ig-like C2-type 2
Glycosylation 203 – 203 N-linked (GlcNAc...) asparagine


Literature citations

Identification of novel L1CAM mutations using fluorescence-assisted mismatch analysis.
Saugier-Veber P.; Martin C.; le Meur N.; Lyonnet S.; Munnich A.; David A.; Henocq A.; Heron D.; Jonveaux P.; Odent S.; Manouvrier S.; Moncla A.; Morichon N.; Philip N.; Satge D.; Tosi M.; Frebourg T.;
Hum. Mutat. 12:259-266(1998)
Cited for: VARIANTS HSAS/MASA ARG-335 AND CYS-473; VARIANTS HSAS THR-219; CYS-386 AND LEU-1224;

L1CAM and its cell-surface mutants: new mechanisms and effects relevant to the physiology and pathology of neural cells.
Tagliavacca L.; Colombo F.; Racchetti G.; Meldolesi J.;
J. Neurochem. 124:397-409(2013)
Cited for: CHARACTERIZATION OF VARIANTS MASA GLN-210 AND LYS-309; CHARACTERIZATION OF VARIANTS HSAS THR-219 AND CYS-264; CHARACTERIZATION OF VARIANT HSAS/MASA LEU-941; SUBCELLULAR LOCATION;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.