Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P32004: Variant p.Gly698Arg

Neural cell adhesion molecule L1
Gene: L1CAM
Feedback?
Variant information Variant position: help 698 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Arginine (R) at position 698 (G698R, p.Gly698Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In HYCX and MASA; also found in a patient affected by hydrocephalus with Hirschsprung disease. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 698 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1257 The length of the canonical sequence.
Location on the sequence: help KLSPYVHYTFRVTAINKYGP G EPSPVSETVVTPEAAPEKNP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         KLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNP

Mouse                         KLSPYVHYTFRVTAINKYGPGEPSPVSESVVTPEAAPEKNP

Rat                           KLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNP

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 20 – 1257 Neural cell adhesion molecule L1
Topological domain 20 – 1120 Extracellular
Domain 615 – 712 Fibronectin type-III 1
Region 698 – 725 Disordered



Literature citations
Multiple exon screening using restriction endonuclease fingerprinting (REF): detection of six novel mutations in the L1 cell adhesion molecule (L1CAM) gene.
Du Y.-Z.; Srivastava A.K.; Schwartz C.E.;
Hum. Mutat. 11:222-230(1998)
Cited for: VARIANTS MASA ASP-691 AND ARG-698; VARIANTS HYCX ARG-698 AND PRO-935;
The site of a missense mutation in the extracellular Ig or FN domains of L1CAM influences infant mortality and the severity of X linked hydrocephalus.
Michaelis R.C.; Du Y.-Z.; Schwartz C.E.;
J. Med. Genet. 35:901-904(1998)
Cited for: VARIANTS HYCX CYS-674; ASP-691 AND ARG-698;
Association of X-linked hydrocephalus and Hirschsprung disease: Report of a new patient with a mutation in the L1CAM gene.
Fernandez R.M.; Nunez-Torres R.; Garcia-Diaz L.; de Agustin J.C.; Antinolo G.; Borrego S.;
Am. J. Med. Genet. A 158:816-820(2012)
Cited for: VARIANT HYCX ARG-698;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.