Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P16144: Variant p.Arg1281Trp

Integrin beta-4
Gene: ITGB4
Feedback?
Variant information Variant position: help 1281 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Arginine (R) to Tryptophan (W) at position 1281 (R1281W, p.Arg1281Trp). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from large size and basic (R) to large size and aromatic (W) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In JEB5B; abolishes interaction with PLEC and reduces interaction with COL17A1. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 1281 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 1822 The length of the canonical sequence.
Location on the sequence: help NDDNRPIGPMKKVLVDNPKN R MLLIENLRESQPYRYTVKAR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKAR

Mouse                         NEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKAR

Rat                           NEDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKAR

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 28 – 1822 Integrin beta-4
Topological domain 734 – 1822 Cytoplasmic
Domain 1222 – 1321 Fibronectin type-III 2
Alternative sequence 965 – 1822 Missing. In isoform Beta-4E.



Literature citations
Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly.
Koster J.; Geerts D.; Favre B.; Borradori L.; Sonnenberg A.;
J. Cell Sci. 116:387-399(2003)
Cited for: FUNCTION; INTERACTION WITH COL17A1 AND DST; CHARACTERIZATION OF VARIANT TRP-1281; SUBCELLULAR LOCATION; Novel ITGB4 mutations in lethal and nonlethal variants of epidermolysis bullosa with pyloric atresia: missense versus nonsense.
Pulkkinen L.; Rouan F.; Bruckner-Tuderman L.; Wallerstein R.; Garzon M.; Brown T.; Smith L.; Carter W.G.; Uitto J.;
Am. J. Hum. Genet. 63:1376-1387(1998)
Cited for: VARIANTS JEB5B TYR-61; CYS-252; ARG-562 AND TRP-1281; Congenital focal segmental glomerulosclerosis associated with beta4 integrin mutation and epidermolysis bullosa.
Kambham N.; Tanji N.; Seigle R.L.; Markowitz G.S.; Pulkkinen L.; Uitto J.; D'Agati V.D.;
Am. J. Kidney Dis. 36:190-196(2000)
Cited for: VARIANT JEB5B TRP-1281;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.