Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P21802: Variant p.Ser252Phe

Fibroblast growth factor receptor 2
Gene: FGFR2
Feedback?
Variant information Variant position: help 252 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Serine (S) to Phenylalanine (F) at position 252 (S252F, p.Ser252Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from small size and polar (S) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In APRS; requires 2 nucleotide substitutions. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 252 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 821 The length of the canonical sequence.
Location on the sequence: help VVENEYGSINHTYHLDVVER S PHRPILQAGLPANASTVVGG The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGG

Mouse                         LVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGG

Chicken                       IVENQYGSINHTYHLDVVERSPHRPILQAGLPANASAVVGG

Xenopus laevis                IVENEHGSINHTYHLDVIERSSHRPILQAGLPANTTAVVGG

Zebrafish                     LVENQYGSIDHTYTLDVVERSPHRPILQAGLPANVTVQVGQ

Drosophila                    KVCNAWGCIQFDFSVQINDRTRSAPIIV--VPQNQTVKVNG
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 22 – 821 Fibroblast growth factor receptor 2
Topological domain 22 – 377 Extracellular
Glycosylation 241 – 241 N-linked (GlcNAc...) asparagine
Glycosylation 265 – 265 N-linked (GlcNAc...) asparagine
Alternative sequence 250 – 361 Missing. In isoform 17.
Alternative sequence 250 – 254 ERSPH -> GSQGL. In isoform 8.
Mutagenesis 265 – 265 N -> Q. Reduced N-glycosylation. Reduced expression at the cell surface.



Literature citations
Genotype-phenotype correlation for nucleotide substitutions in the IgII-IgIII linker of FGFR2.
Oldridge M.; Lunt P.W.; Zackai E.H.; McDonald-Mcginn D.M.; Muenke M.; Moloney D.M.; Twigg S.R.F.; Heath J.K.; Howard T.D.; Hoganson G.; Gagnon D.M.; Jabs E.W.; Wilkie A.O.M.;
Hum. Mol. Genet. 6:137-143(1997)
Cited for: VARIANT LEU-252; VARIANT APRS PHE-252; VARIANT PS 252-SER-PRO-253 DELINS PHE-SER;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.