Variant position:  342

Type of variant:  LP/P [Disclaimer: Variants classification is intended for research purposes only, not for clinical and diagnostic use. The label disease variant is assigned according to literature reports on probable disease-association that can be based on theoretical reasons. This label must not be considered as a definitive proof for the pathogenic role of a variant.]

Residue change:  From Cysteine (C) to Tyrosine (Y) at position 342 (C342Y, p.Cys342Tyr).

Physico-chemical properties:  Change from medium size and polar (C) to large size and aromatic (Y)

BLOSUM score:  -2

Variant description:  In CS and PS.

Other resources:  

• Variant rs121918487 [ dbSNP | Ensembl ]

Variant position:  342

Protein sequence length:  821

Location on the sequence:   KEIEVLYIRNVTFEDAGEYT  C LAGNSIGISFHSAWLTVLPA

Residue conservation: 

Human                         KEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL----PA

Mouse                         KEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL--

Chicken                       KEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHTAWLTVL--

Xenopus laevis                EEIEVLYVRNVSFEDAGEYTCIAGNSIGISQHSAWLTVH--

Zebrafish                     KEIEVLYLPNVTFEDAGEYTCLAGNSIGISYHTAWLTVH--

Drosophila                    DSV-VLTLRNVTFDQEGWYTCLASSGLGRSNSSVYLRVVSP

Sequence annotation in neighborhood:  

Crouzon syndrome: mutations in two spliceoforms of FGFR2 and a common point mutation shared with Jackson-Weiss syndrome.
Gorry M.C.; Preston R.A.; White G.J.; Zhang Y.; Singhal V.K.; Losken H.W.; Parker M.G.; Nwokoro N.A.; Post J.C.; Ehrlich G.D.;
Hum. Mol. Genet. 4:1387-1390(1995)
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 263-361; VARIANTS CS PRO-289; ARG-338; SER-342; TYR-342; GLY-344 AND CYS-354;

Mutations in the fibroblast growth factor receptor 2 gene cause Crouzon syndrome.
Reardon W.; Winter R.M.; Rutland P.; Pulleyn L.J.; Jones B.M.; Malcolm S.;
Nat. Genet. 8:98-103(1994)
Cited for: VARIANTS CS HIS-340; ARG-342; SER-342; TYR-342 AND CYS-354;

Identical mutations in the FGFR2 gene cause both Pfeiffer and Crouzon syndrome phenotypes.
Rutland P.; Pulleyn L.J.; Reardon W.; Baraister M.; Hayward R.; Jones B.M.; Malcolm S.; Winter R.M.; Oldridge M.; Slaney S.F.; Poole M.D.; Wilkie A.O.M.;
Nat. Genet. 9:173-176(1995)
Cited for: VARIANTS PS PRO-341; ARG-342 AND TYR-342;

FGFR2 exon IIIa and IIIc mutations in Crouzon, Jackson-Weiss, and Pfeiffer syndromes: evidence for missense changes, insertions, and a deletion due to alternative RNA splicing.
Meyers G.A.; Day D.; Goldberg R.; Daentl D.L.; Przylepa K.A.; Abrams L.J.; Graham J.M. Jr.; Feingold M.; Moeschler J.B.; Rawnsley E.; Scott A.F.; Jabs E.W.;
Am. J. Hum. Genet. 58:491-498(1996)
Cited for: VARIANTS CS GLY-268 INS; PHE-342 AND TYR-342; VARIANTS PS PHE-278; ARG-342; SER-342; PRO-344 AND PHE-359; VARIANT JWS PRO-289;

Description of a new mutation and characterization of FGFR1, FGFR2, and FGFR3 mutations among Brazilian patients with syndromic craniosynostoses.
Passos-Bueno M.R.; Sertie A.L.; Richieri-Costa A.; Alonso L.G.; Zatz M.; Alonso N.; Brunoni D.; Ribeiro S.F.M.;
Am. J. Med. Genet. 78:237-241(1998)
Cited for: VARIANTS CS PHE-278; PRO-337; ARG-338; ARG-342; PHE-342 AND TYR-342; VARIANTS APRS TRP-252 AND ARG-253; VARIANT JWS PHE-278;

Clustering of FGFR2 gene mutations in patients with Pfeiffer and Crouzon syndromes (FGFR2-associated craniosynostoses).
Kress W.; Collmann H.; Buesse M.; Halliger-Keller B.; Mueller C.R.;
Cytogenet. Cell Genet. 91:134-137(2000)
Cited for: VARIANTS CS/PS ARG-342 AND TYR-342; VARIANTS CS LEU-263; VAL-276; PHE-278; TYR-278; SER-288; PRO-289; PRO-341; TRP-342; CYS-354; TYR-354 AND PHE-359; VARIANT PS SER-342;

Mutation analysis of Crouzon syndrome and identification of one novel mutation in Taiwanese patients.
Tsai F.-J.; Yang C.-F.; Wu J.-Y.; Tsai C.-H.; Lee C.-C.;
Pediatr. Int. 43:263-266(2001)
Cited for: VARIANTS CS CYS-281; PRO-289; ARG-342 AND TYR-342;

Genomic screening of fibroblast growth-factor receptor 2 reveals a wide spectrum of mutations in patients with syndromic craniosynostosis.
Kan S.-H.; Elanko N.; Johnson D.; Cornejo-Roldan L.R.; Cook J.; Reich E.W.; Tomkins S.; Verloes A.; Twigg S.R.F.; Rannan-Eliya S.; McDonald-McGinn D.M.; Zackai E.H.; Wall S.A.; Muenke M.; Wilkie A.O.M.;
Am. J. Hum. Genet. 70:472-486(2002)
Cited for: VARIANTS CS CYS-105; PRO-267; VAL-276; CYS-281; PRO-289; ARG-338; HIS-340; PHE-342; TRP-342; CYS-347; CYS-354; HIS-549 AND GLY-678; VARIANTS PS PHE-172; 252-PHE-SER-253; CYS-290; CYS-340; PRO-341; ARG-342; SER-342; CYS-375; GLY-565; ARG-641 AND GLU-663; VARIANTS APRS TRP-252 AND ARG-253; VARIANTS CS/PS PHE-278 AND TYR-342; VARIANT CRANIOSYNOSTOSIS ASN-659; VARIANTS THR-186 AND SER-315;