Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P22607: Variant p.Pro250Arg

Fibroblast growth factor receptor 3
Gene: FGFR3
Feedback?
Variant information Variant position: help 250 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Proline (P) to Arginine (R) at position 250 (P250R, p.Pro250Arg). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (P) to large size and basic (R) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -2 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MNKS; also some individuals with autosomal dominant congenital sensorineural deafness without craniosynostosis. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 250 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 806 The length of the canonical sequence.
Location on the sequence: help VENKFGSIRQTYTLDVLERS P HRPILQAGLPANQTAVLGSD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSD

Mouse                         VENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAILGSD

Chicken                       VENKYGNIRHTYQLDVLERSPHRPILQAGLPANQTVVVGSN

Xenopus laevis                VENKYGSIRQTYQLDVLERSSHRPILQAGLPGNQTVVLGSD

Zebrafish                     VQNKYGSIKHTYQLDVLERSPHRPILQAGLPANQTVVVGSD
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 23 – 806 Fibroblast growth factor receptor 3
Topological domain 23 – 375 Extracellular
Glycosylation 262 – 262 N-linked (GlcNAc...) asparagine



Literature citations
A unique point mutation in the fibroblast growth factor receptor 3 gene (FGFR3) defines a new craniosynostosis syndrome.
Muenke M.; Gripp K.W.; McDonald-Mcginn D.M.; Gaudenz K.; Whitaker L.A.; Bartlett S.P.; Markowitz R.I.; Robin N.H.; Nwokoro N.; Mulvihill J.J.; Losken H.W.; Mulliken J.B.; Guttmacher A.E.; Wilroy R.S.; Clarke L.A.; Hollway G.; Ades L.C.; Haan E.A.; Mulley J.C.; Cohen M.M. Jr.; Bellus G.A.; Francomano C.A.; Moloney D.M.; Wall S.A.; Wilkie A.O.M.; Zackai E.H.;
Am. J. Hum. Genet. 60:555-564(1997)
Cited for: VARIANT MNKS ARG-250; Deafness due to Pro250Arg mutation of FGFR3.
Hollway G.E.; Suthers G.K.; Battese K.M.; Turner A.M.; David D.J.; Mulley J.C.;
Lancet 351:877-878(1998)
Cited for: VARIANT ARG-250; Sex related expressivity of the phenotype in coronal craniosynostosis caused by the recurrent P250R FGFR3 mutation.
Lajeunie E.; El Ghouzzi V.; Le Merrer M.; Munnich A.; Bonaventure J.; Renier D.;
J. Med. Genet. 36:9-13(1999)
Cited for: VARIANT MNKS ARG-250; Syndrome of coronal craniosynostosis, Klippel-Feil anomaly, and sprengel shoulder with and without Pro250Arg mutation in the FGFR3 gene.
Lowry R.B.; Jabs E.W.; Graham G.E.; Gerritsen J.; Fleming J.;
Am. J. Med. Genet. 104:112-119(2001)
Cited for: VARIANT MNKS ARG-250;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.