Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot Q13093: Variant p.Val279Phe

Platelet-activating factor acetylhydrolase
Gene: PLA2G7
Feedback?
Variant information Variant position: help 279 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Valine (V) to Phenylalanine (F) at position 279 (V279F, p.Val279Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (V) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In PAFAD; loss of function; risk factor for coronary arthery disease and stroke. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 279 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 441 The length of the canonical sequence.
Location on the sequence: help KDSIDREKIAVIGHSFGGAT V IQTLSEDQRFRCGIALDAWM The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         KDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWM

                              KDSIDRDKIAVIGHSFGGATVLQALSEDQRFRCGIALDAWM

Mouse                         KDAIDETKIALMGHSFGGATVLQALSEDQRFRCGVALDPWM

Bovine                        KDSIDRDKIAIIGHSFGGATVIQTLSEDQRFRCGIALDAWM

Chicken                       KDSVDTSRIAVMGHSFGGATVIESLSKEIRFRCGIALDAWM

Caenorhabditis elegans        KNKLVMSSASVIGHSFGGATSLASSAYTTDFQKAIVFDGWM
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 22 – 441 Platelet-activating factor acetylhydrolase
Active site 273 – 273 Nucleophile
Active site 296 – 296 Charge relay system
Mutagenesis 273 – 273 S -> A. Loss of activity.
Mutagenesis 286 – 286 D -> A. Almost no activity.
Mutagenesis 286 – 286 D -> N. Diminishes activity.
Mutagenesis 296 – 296 D -> A. Loss of activity.
Mutagenesis 296 – 296 D -> N. Loss of activity.
Helix 274 – 285



Literature citations
Release of free F2-isoprostanes from esterified phospholipids is catalyzed by intracellular and plasma platelet-activating factor acetylhydrolases.
Stafforini D.M.; Sheller J.R.; Blackwell T.S.; Sapirstein A.; Yull F.E.; McIntyre T.M.; Bonventre J.V.; Prescott S.M.; Roberts L.J. II;
J. Biol. Chem. 281:4616-4623(2006)
Cited for: FUNCTION; CATALYTIC ACTIVITY; BIOPHYSICOCHEMICAL PROPERTIES; VARIANT PHE-279; Platelet-activating factor acetylhydrolase deficiency. A missense mutation near the active site of an anti-inflammatory phospholipase.
Stafforini D.M.; Satoh K.; Atkinson D.L.; Tjoelker L.W.; Eberhardt C.; Yoshida H.; Imaizumi T.; Takamatsu S.; Zimmerman G.A.; McIntyre T.M.; Gray P.W.; Prescott S.M.;
J. Clin. Invest. 97:2784-2791(1996)
Cited for: VARIANT PAFAD PHE-279; FUNCTION; CATALYTIC ACTIVITY; A mutation in plasma platelet-activating factor acetylhydrolase (Val279-->Phe) is a genetic risk factor for stroke.
Hiramoto M.; Yoshida H.; Imaizumi T.; Yoshimizu N.; Satoh K.;
Stroke 28:2417-2420(1997)
Cited for: VARIANT PAFAD PHE-279; Identification of the G994--> T missense in exon 9 of the plasma platelet-activating factor acetylhydrolase gene as an independent risk factor for coronary artery disease in Japanese men.
Yamada Y.; Ichihara S.; Fujimura T.; Yokota M.;
Metabolism 47:177-181(1998)
Cited for: VARIANT PAFAD PHE-279; A mutation in plasma platelet-activating factor acetylhydrolase (Val279Phe) is a genetic risk factor for cerebral hemorrhage but not for hypertension.
Yoshida H.; Imaizumi T.; Fujimoto K.; Itaya H.; Hiramoto M.; Yoshimizu N.; Fukushi K.; Satoh K.;
Thromb. Haemost. 80:372-375(1998)
Cited for: VARIANT PAFAD PHE-279;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.