Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P10253: Variant p.Pro545Leu

Lysosomal alpha-glucosidase
Gene: GAA
Feedback?
Variant information Variant position: help 545 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Proline (P) to Leucine (L) at position 545 (P545L, p.Pro545Leu). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In GSD2; mild; partial loss of activity. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 545 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 952 The length of the canonical sequence.
Location on the sequence: help FIRGSEDGCPNNELENPPYV P GVVGGTLQAATICASSHQFL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         FIRGSEDGCPNNELENPPYVPGVVGGTLQAATICASSHQFL

Mouse                         FVRGSQQGCPNNELENPPYVPGVVGGILQAATICASSHQFL

Rat                           FIRGSQQGCPDNELENPPYVPGVVGGALQAATICASSHQFL

Bovine                        FVRGSVDGCPDNSLENPPYLPGVVGGTLRAATICASSHQFL
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 70 – 952 Lysosomal alpha-glucosidase
Chain 123 – 952 76 kDa lysosomal alpha-glucosidase
Chain 204 – 952 70 kDa lysosomal alpha-glucosidase
Disulfide bond 533 – 558



Literature citations
The effect of a single base pair deletion (delta T525) and a C1634T missense mutation (Pro545Leu) on the expression of lysosomal alpha-glucosidase in patients with glycogen storage disease type II.
Hermans M.M.P.; de Graaff E.; Kroos M.A.; Mohkamsing S.; Eussen B.J.; Joosse M.; Willemsen R.; Kleijer W.J.; Oostra B.A.; Reuser A.J.J.;
Hum. Mol. Genet. 3:2213-2218(1994)
Cited for: VARIANT GSD2 LEU-545; Adult-onset glycogen storage disease type II: phenotypic and allelic heterogeneity in German patients.
Vorgerd M.; Burwinkel B.; Reichmann H.; Malin J.-P.; Kilimann M.W.;
Neurogenetics 1:205-211(1998)
Cited for: VARIANTS GSD2 LEU-545 AND TRP-638; Twenty-two novel mutations in the lysosomal alpha-glucosidase gene (GAA) underscore the genotype-phenotype correlation in glycogen storage disease type II.
Hermans M.M.P.; van Leenen D.; Kroos M.A.; Beesley C.E.; Van der Ploeg A.T.; Sakuraba H.; Wevers R.; Kleijer W.J.; Michelakakis H.; Kirk E.P.; Fletcher J.; Bosshard N.; Basel-Vanagaite L.; Besley G.; Reuser A.J.J.;
Hum. Mutat. 23:47-56(2004)
Cited for: VARIANTS GSD2 GLY-103; ARG-219; ARG-285; CYS-292; ARG-293; PRO-308; ARG-312; PRO-355; ARG-374; PRO-405; PHE-455; ASP-459 DEL; ARG-478; ARG-481; THR-519; LEU-545; ARG-549; PRO-552; SER-575; LYS-579; CYS-600; ASP-607 AND ASP-880; CHARACTERIZATION OF VARIANTS; FUNCTION; Genetic heterozygosity and pseudodeficiency in the Pompe disease newborn screening pilot program.
Labrousse P.; Chien Y.H.; Pomponio R.J.; Keutzer J.; Lee N.C.; Akmaev V.R.; Scholl T.; Hwu W.L.;
Mol. Genet. Metab. 99:379-383(2010)
Cited for: VARIANTS GSD2 PRO-224; LEU-251; LEU-254; LYS-262; SER-266; PRO-291; VAL-408; ARG-478; TYR-525; LEU-545; PHE-557; ARG-615; GLU-645; GLY-746 AND CYS-746; VARIANTS ALA-271 AND ARG-711;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.