Home  |  Contact

UniProtKB/Swiss-Prot P40692: Variant p.His718Tyr

DNA mismatch repair protein Mlh1
Gene: MLH1
Variant information

Variant position:  718
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  US
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Histidine (H) to Tyrosine (Y) at position 718 (H718Y, p.His718Tyr).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (H) to large size and aromatic (Y)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In HNPCC2; unknown pathological significance.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  718
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  756
The length of the canonical sequence.

Location on the sequence:   SGQQSEVPGSIPNSWKWTVE  H IVYKALRSHILPPKHFTEDG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         SGQQSEVPGSIPNSW--------KWTVEHIVYKALRSHILPPKHFTEDG

Mouse                         SGQQSDMPGSTSKPW--------KWTVEHIIYKAFRSHLLP

Rat                           SGQQSDMPGSPSKPW--------KWTVEHIIYKAFRSHLLP

Slime mold                    NNQQQTNSTTTTNNINFIKKDGKEWIIQHLIFPAFR-KLSP

Baker's yeast                 SEDEKAQFINRKEHI--------SSLLEHVLFPCIKRRFLA

Fission yeast                 SYEESDVKSIRSL----------ESCLEDYLFPEFRRRVIC

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 2 – 756 DNA mismatch repair protein Mlh1
Helix 712 – 718


Literature citations

Novel hMLH1 and hMSH2 germline mutations in African Americans with colorectal cancer.
Weber T.K.; Chin H.-M.; Rodriguez-Bigas M.; Keitz B.; Gilligan R.; O'Malley L.; Urf E.; Diba N.; Pazik J.; Petrelli N.J.;
JAMA 281:2316-2320(1999)
Cited for: VARIANT HNPCC2 PHE-25; VARIANT TYR-718;

hMLH1 and hMSH2 gene mutation in Brazilian families with suspected hereditary nonpolyposis colorectal cancer.
Rossi B.M.; Lopes A.; Oliveira Ferreira F.; Nakagawa W.T.; Napoli Ferreira C.C.; Casali Da Rocha J.C.; Simpson C.C.; Simpson A.J.G.;
Ann. Surg. Oncol. 9:555-561(2002)
Cited for: VARIANTS HNPCC2 SER-338; ARG-603; THR-618 AND TYR-718;

Classification of ambiguous mutations in DNA mismatch repair genes identified in a population-based study of colorectal cancer.
Barnetson R.A.; Cartwright N.; van Vliet A.; Haq N.; Drew K.; Farrington S.; Williams N.; Warner J.; Campbell H.; Porteous M.E.; Dunlop M.G.;
Hum. Mutat. 29:367-374(2008)
Cited for: VARIANTS CRC GLU-67 AND THR-681; VARIANTS ALA-22; GLY-93; SER-309; ASN-406; HIS-607; ALA-618; ARG-689; MET-716; TYR-718 AND ARG-751;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.