Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P23560: Variant p.Val66Met

Neurotrophic factor BDNF precursor form
Gene: BDNF
Feedback?
Variant information Variant position: help 66 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LB/B The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Valine (V) to Methionine (M) at position 66 (V66M, p.Val66Met). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Similar physico-chemical property. Both residues are medium size and hydrophobic. The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help Risk factor for eating disorders such as anorexia nervosa and bulimia nervosa; risk factor for poorer episodic memory; may have a protective effect in obsessive-compulsive disorder; impairs localization to secretory granules or synapses; decreases density of dendritic mushroom spines and synapses. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 66 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 247 The length of the canonical sequence.
Location on the sequence: help VNGPKAGSRGLTSLADTFEH V IEELLDEDQKVRPNEENNKD The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         VNGPKAGSRGLT-----SLADTFEHVIEELLDEDQKVRPNEENNKD

                              VSGPKAGSRGLT-----SLADTFEHVIEELLDEDQKVRPNE

Chimpanzee                    VNGPKAGSRGLT-----SLADTFEHVIEELLDEDQKVRPNE

Mouse                         VNGPRAGSRGLT---TTSLADTFEHVIEELLDEDQKVRPNE

Rat                           VNGPRAGSRGLT---TTSLADTFEHVIEELLDEDQKVRPNE

Pig                           VNGPKAGSRGLTSSSSSSLADTFEHVIEELLDEDQKVRPNE

Bovine                        MNGPKVGSRGLT--SSSSLADTFEHVIEELLDEDQKVRPSE

Cat                           VNGPKAGSRRLT-----SLADTFEHVIEELLDEDQKGRPNE

Horse                         VNGPKAGSRGLT-----SLADTFEHVIEDLLDEGQKVRPDE

Chicken                       LTGPNAGSRGLT-----SLADTFEHVIEELLDEDQDIQPSE

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 19 – 247 Neurotrophic factor BDNF precursor form
Propeptide 19 – 128
Mutagenesis 54 – 54 R -> A. Abolishes processing by MBTPS1.



Literature citations
Submission
Perez-Pinera P.; Gonzalez-Martinez T.; Garcia-Suarez O.; Perez-Perez M.; Esteban I.; Monjil D.; Vega J.A.;
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT MET-66; Identification of pro- and mature brain-derived neurotrophic factor in human saliva.
Mandel A.L.; Ozdener H.; Utermohlen V.;
Arch. Oral Biol. 54:689-695(2009)
Cited for: SUBCELLULAR LOCATION; PROTEOLYTIC CLEAVAGE; VARIANT MET-66; GLYCOSYLATION AT ASN-121; TISSUE SPECIFICITY; Association of BDNF with anorexia, bulimia and age of onset of weight loss in six European populations.
Ribases M.; Gratacos M.; Fernandez-Aranda F.; Bellodi L.; Boni C.; Anderluh M.; Cavallini M.C.; Cellini E.; Di Bella D.; Erzegovesi S.; Foulon C.; Gabrovsek M.; Gorwood P.; Hebebrand J.; Hinney A.; Holliday J.; Hu X.; Karwautz A.; Kipman A.; Komel R.; Nacmias B.; Remschmidt H.; Ricca V.; Sorbi S.; Wagner G.; Treasure J.; Collier D.A.; Estivill X.;
Hum. Mol. Genet. 13:1205-1212(2004)
Cited for: VARIANT MET-66; Characterization of single-nucleotide polymorphisms in coding regions of human genes.
Cargill M.; Altshuler D.; Ireland J.; Sklar P.; Ardlie K.; Patil N.; Shaw N.; Lane C.R.; Lim E.P.; Kalyanaraman N.; Nemesh J.; Ziaugra L.; Friedland L.; Rolfe A.; Warrington J.; Lipshutz R.; Daley G.Q.; Lander E.S.;
Nat. Genet. 22:231-238(1999)
Cited for: VARIANT MET-66; Sequence variants of the brain-derived neurotrophic factor (BDNF) gene are strongly associated with obsessive-compulsive disorder.
Hall D.; Dhilla A.; Charalambous A.; Gogos J.A.; Karayiorgou M.;
Am. J. Hum. Genet. 73:370-376(2003)
Cited for: VARIANT MET-66; ROLE OF VARIANT MET-66 IN OBSESSIVE-COMPULSIVE DISORDER; The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function.
Egan M.F.; Kojima M.; Callicott J.H.; Goldberg T.E.; Kolachana B.S.; Bertolino A.; Zaitsev E.; Gold B.; Goldman D.; Dean M.; Lu B.; Weinberger D.R.;
Cell 112:257-269(2003)
Cited for: VARIANT MET-66; CHARACTERIZATION OF VARIANT MET-66; ROLE IN EPISODIC MEMORY; Molecular analysis of congenital central hypoventilation syndrome.
Sasaki A.; Kanai M.; Kijima K.; Akaba K.; Hashimoto M.; Hasegawa H.; Otaki S.; Koizumi T.; Kusuda S.; Ogawa Y.; Tuchiya K.; Yamamoto W.; Nakamura T.; Hayasaka K.;
Hum. Genet. 114:22-26(2003)
Cited for: VARIANT MET-66; Met66 in the brain-derived neurotrophic factor (BDNF) precursor is associated with anorexia nervosa restrictive type.
Ribases M.; Gratacos M.; Armengol L.; de Cid R.; Badia A.; Jimenez L.; Solano R.; Vallejo J.; Fernandez F.; Estivill X.;
Mol. Psychiatry 8:745-751(2003)
Cited for: VARIANT MET-66; ASSOCIATION OF VARIANT MET-66 WITH ANR; The BDNF Val66Met Prodomain Disassembles Dendritic Spines Altering Fear Extinction Circuitry and Behavior.
Giza J.I.; Kim J.; Meyer H.C.; Anastasia A.; Dincheva I.; Zheng C.I.; Lopez K.; Bains H.; Yang J.; Bracken C.; Liston C.; Jing D.; Hempstead B.L.; Lee F.S.;
Neuron 99:163-178(2018)
Cited for: FUNCTION; CHARACTERIZATION OF VARIANT MET-66;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.