Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P12694: Variant p.Ile326Thr

2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
Gene: BCKDHA
Feedback?
Variant information Variant position: help 326 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Isoleucine (I) to Threonine (T) at position 326 (I326T, p.Ile326Thr). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (I) to medium size and polar (T) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In MSUD1A; decreased 3-methyl-2-oxobutanoate dehydrogenase activity. Any additional useful information about the variant.


Sequence information Variant position: help 326 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 445 The length of the canonical sequence.
Location on the sequence: help VYNATKEARRRAVAENQPFL I EAMTYRIGHHSTSDDSSAYR The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         VYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYR

Chimpanzee                    VYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYR

Mouse                         VYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYR

Bovine                        VYNATKEARRRAVAENQPFLIEAMTYRIGHHSTSDDSSAYR

Caenorhabditis elegans        VYNATKEARRVALT-NRPVLIEAMTYRLGHHSTSDDSTAYR

Slime mold                    VYNVTKLARKIAVEEQVPVLIEAMTYRVGHHSTSDDSSRYR
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 46 – 445 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
Binding site 336 – 336
Modified residue 337 – 337 Phosphoserine; by BCKDK
Modified residue 338 – 338 Phosphothreonine
Modified residue 339 – 339 Phosphoserine
Alternative sequence 331 – 331 Y -> YSSSPILPPDPHSREPTLTWGPLPLC. In isoform 2.
Mutagenesis 337 – 337 S -> A. Substantially decreases the stability of the BCKD complex.
Beta strand 324 – 329



Literature citations
Heterogeneity of mutations in maple syrup urine disease (MSUD): screening and identification of affected E1 alpha and E1 beta subunits of the branched-chain alpha-keto-acid dehydrogenase multienzyme complex.
Nobukuni Y.; Mitsubuchi H.; Hayashida Y.; Ohta K.; Indo Y.; Ichiba Y.; Endo F.; Matsuda I.;
Biochim. Biophys. Acta 1225:64-70(1993)
Cited for: VARIANTS MSUD1A TRP-159; LYS-190; THR-253 AND THR-326;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.