Home  |  Contact

UniProtKB/Swiss-Prot Q92838: Variant p.Arg156His

Ectodysplasin-A
Gene: EDA
Variant information

Variant position:  156
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Arginine (R) to Histidine (H) at position 156 (R156H, p.Arg156His).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from large size and basic (R) to medium size and polar (H)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Ectodermal dysplasia 1, hypohidrotic, X-linked (XHED) [MIM:305100]: A form of ectodermal dysplasia, a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. Characterized by sparse hair (atrichosis or hypotrichosis), abnormal or missing teeth and the inability to sweat due to the absence of sweat glands. It is the most common form of over 150 clinically distinct ectodermal dysplasias. {ECO:0000269|PubMed:10469321, ECO:0000269|PubMed:10951256, ECO:0000269|PubMed:11279189, ECO:0000269|PubMed:11295832, ECO:0000269|PubMed:11309369, ECO:0000269|PubMed:11343303, ECO:0000269|PubMed:11378824, ECO:0000269|PubMed:11416205, ECO:0000269|PubMed:12225002, ECO:0000269|PubMed:12932274, ECO:0000269|PubMed:17256800, ECO:0000269|PubMed:18231121, ECO:0000269|PubMed:19127222, ECO:0000269|PubMed:19438931, ECO:0000269|PubMed:20486090, ECO:0000269|PubMed:20979233, ECO:0000269|PubMed:22008666, ECO:0000269|PubMed:22350046, ECO:0000269|PubMed:24724966, ECO:0000269|PubMed:27144394, ECO:0000269|PubMed:27657131, ECO:0000269|PubMed:8696334, ECO:0000269|PubMed:9507389, ECO:0000269|PubMed:9630076, ECO:0000269|PubMed:9683615, ECO:0000269|PubMed:9736768}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In XHED; abolishes proteolytic processing.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  156
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  391
The length of the canonical sequence.

Location on the sequence:   LNFFFPDEKPYSEEESRRVR  R NKRSKSNEGADGPVKNKKKG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         LNFFFPDEKPYSEEESRRVRRNKRSKSNEGADGPVKNKKKG

Mouse                         LNFFFPDEKAYSEEESRRVRRNKRSKSGEGADGPVKNKKKG

Bovine                        VNFFIPKEKSYSEEESRRVRRNKRSKSSEGADGPVKNKKKG

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 391 Ectodysplasin-A, membrane form
Topological domain 63 – 391 Extracellular
Alternative sequence 136 – 391 Missing. In isoform 2.
Alternative sequence 143 – 391 Missing. In isoform 5.
Alternative sequence 148 – 391 Missing. In isoform 4, isoform 6 and isoform 7.
Mutagenesis 159 – 159 R -> A. Abolishes proteolytic processing.


Literature citations

Ectodysplasin is released by proteolytic shedding and binds to the EDAR protein.
Elomaa O.; Pulkkinen K.; Hannelius U.; Mikkola M.; Saarialho-Kere U.; Kere J.;
Hum. Mol. Genet. 10:953-962(2001)
Cited for: PROTEOLYTIC PROCESSING; CHARACTERIZATION OF VARIANT XHED CYS-153; CHARACTERIZATION OF VARIANT HIS-156;

Mutations within a furin consensus sequence block proteolytic release of ectodysplasin-A and cause X-linked hypohidrotic ectodermal dysplasia.
Chen Y.; Molloy S.S.; Thomas L.; Gambee J.; Baechinger H.P.; Ferguson B.M.; Zonana J.; Thomas G.; Morris N.P.;
Proc. Natl. Acad. Sci. U.S.A. 98:7218-7223(2001)
Cited for: CHARACTERIZATION OF VARIANTS XHED CYS-153; CYS-155; CYS-156; HIS-156 AND ASN-158; MUTAGENESIS OF ARG-159; CLEAVAGE SITE;

The mutation spectrum of the EDA gene in X-linked anhidrotic ectodermal dysplasia.
Paeaekkoenen K.; Cambiaghi S.; Novelli G.; Ouzts L.V.; Penttinen M.; Kere J.; Srivastava A.K.;
Hum. Mutat. 17:349-349(2001)
Cited for: VARIANTS XHED CYS-156; HIS-156; CYS-255; ASP-255; GLY-274; TYR-332 AND THR-349;

Mutations leading to X-linked hypohidrotic ectodermal dysplasia affect three major functional domains in the tumor necrosis factor family member ectodysplasin-A.
Schneider P.; Street S.L.; Gaide O.; Hertig S.; Tardivel A.; Tschopp J.; Runkel L.; Alevizopoulos K.; Ferguson B.M.; Zonana J.;
J. Biol. Chem. 276:18819-18827(2001)
Cited for: VARIANTS XHED CYS-153; CYS-155; CYS-156; HIS-156; ASN-158; 183-GLY--PRO-194 DEL; 185-ASN--PRO-196 DEL; GLU-189; 191-PRO--PRO-196 DEL; ARG-207; ASP-218; 218-GLY--PRO-223 DEL; ARG-291; SER-299; CYS-320; CYS-343; ARG-374; PRO-378 AND MET-378;

Mutation screening of the ectodysplasin-A receptor gene EDAR in hypohidrotic ectodermal dysplasia.
van der Hout A.H.; Oudesluijs G.G.; Venema A.; Verheij J.B.G.M.; Mol B.G.J.; Rump P.; Brunner H.G.; Vos Y.J.; van Essen A.J.;
Eur. J. Hum. Genet. 16:673-679(2008)
Cited for: VARIANTS XHED CYS-155; CYS-156; HIS-156; 183-GLY--PRO-194 DEL; 184-PRO--GLY-189 DEL; 185-ASN--PRO-196 DEL; ARG-291; TYR-298; GLY-307; ASP-372 AND ILE-373;

Phenotypic heterogeneity and mutational spectrum in a cohort of 45 Italian males subjects with X-linked ectodermal dysplasia.
Guazzarotti L.; Tadini G.; Mancini G.E.; Giglio S.; Willoughby C.E.; Callea M.; Sani I.; Nannini P.; Mameli C.; Tenconi A.A.; Mauri S.; Bottero A.; Caimi A.; Morelli M.; Zuccotti G.V.;
Clin. Genet. 87:338-342(2015)
Cited for: VARIANTS XHED GLN-51; CYS-125; PRO-132; HIS-153; CYS-155; HIS-156; 183-GLY--PRO-194 DEL; 185-ASN--PRO-196 DEL; 191-PRO--PRO-196 DEL; 193-PRO--GLY-201 DEL; 219-PRO--GLY-230 DEL; GLY-274; ARG-291; SER-299; HIS-304; GLU-316; ARG-319; SER-319 DEL; PHE-332; ASP-350; HIS-358 AND VAL-381;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.