UniProtKB/Swiss-Prot Q06787: Variant p.Arg546His

• Variant information
• Sequence information
• Literature citations
• All

Variant information

Variant position: 546 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: LB/B The variants are classified into three categories: LP/P, LB/B and US.

• LP/P: likely pathogenic or pathogenic.
• LB/B: likely benign or benign.
• US: uncertain significance

Residue change: From Arginine (R) to Histidine (H) at position 546 (R546H, p.Arg546His). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: Change from large size and basic (R) to medium size and polar (H) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:

• Lowest score: -4 (low probability of substitution).
• Highest score: 11 (high probability of substitution).

More information can be found on the following page
Other resources: Links to websites of interest for the variant.

• Variant rs782651077 [ dbSNP | Ensembl ]

Sequence information

Variant position: 546 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: 632 The length of the canonical sequence.
Location on the sequence: LRRGDGRRRGGGGRGQGGRG R GGGFKGNDDHSRTDNRPRNP The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Sequence annotation in neighborhood: The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:

• Type: the type of sequence feature.
• Positions: endpoints of the sequence feature.
• Description: contains additional information about the feature.

Type	Positions	Description
Chain	1 – 632	Fragile X messenger ribonucleoprotein 1
Region	419 – 632	Interaction with RANBP9
Region	443 – 632	Disordered
Region	534 – 548	RNA-binding RGG-box
Modified residue	534 – 534	Asymmetric dimethylarginine; alternate
Modified residue	534 – 534	Omega-N-methylarginine; alternate
Modified residue	539 – 539	Asymmetric dimethylarginine; alternate
Modified residue	539 – 539	Omega-N-methylarginine; alternate
Modified residue	544 – 544	Asymmetric dimethylarginine; alternate
Modified residue	544 – 544	Omega-N-methylarginine
Modified residue	544 – 544	Omega-N-methylarginine; alternate
Modified residue	546 – 546	Asymmetric dimethylarginine; alternate
Modified residue	546 – 546	Omega-N-methylarginine; alternate
Alternative sequence	426 – 632	EVDQLRLERLQIDEQLRQIGASSRPPPNRTDKEKSYVTDDGQGMGRGSRPYRNRGHGRRGPGYTSGTNSEASNASETESDHRDELSDWSLAPTEEERESFLRRGDGRRRGGGGRGQGGRGRGGGFKGNDDHSRTDNRPRNPREAKGRTTDGSLQIRVDCNNERSVHTKTLQNTSSEGSRLRTGKDRNQKKEKPDSVDGQQPLVNGVP -> LQQRKRGRASCAEETDGGVEGEEEDKEEEDVEEASKETTITPEQIIVHVIQERLKEEQQMDPFRSELTAIMKGVSTLKHYRIPPVKVVGCARVKIVTRRKRSQTAWMVSNHS. In isoform 10 and isoform 11.
Mutagenesis	544 – 544	R -> K. Reduces arginine methylation by 80%.
Mutagenesis	546 – 546	R -> K. Slightly reduced methylation.

Literature citations

Novel point mutation within intron 10 of FMR-1 gene causing fragile X syndrome.
Wang Y.-C.; Lin M.-L.; Lin S.J.; Li Y.-C.; Li S.-Y.;
Hum. Mutat. 10:393-399(1997)
Cited for: VARIANT HIS-546;