Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P35575: Variant p.Val338Phe

Glucose-6-phosphatase catalytic subunit 1
Gene: G6PC1
Feedback?
Variant information Variant position: help 338 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Valine (V) to Phenylalanine (F) at position 338 (V338F, p.Val338Phe). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and hydrophobic (V) to large size and aromatic (F) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -1 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In GSD1A. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 338 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 357 The length of the canonical sequence.
Location on the sequence: help VELVFYVLSFCKSAVVPLAS V SVIPYCLAQVLGQPHKKSL The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         VELVFYVLSFCKSAVVPLASVSVIPYCLAQVLGQPHKKSL

Mouse                         VELIFYILSFCKSATVPFASVSLIPYCLARILGQTHKKSL

Rat                           IESIFYILSFCKSATVPFASVSLIPYCLARLLGQTHKKSL

Bovine                        IELIFYVLSFCKSAAVPLASVSLIPYCLAWVLGQPNKKTV

Cat                           IELIFYVLSFCKSAAVPLASVSLIPYCLARVLGQPDKKSL

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 1 – 357 Glucose-6-phosphatase catalytic subunit 1
Transmembrane 321 – 341 Helical
Alternative sequence 176 – 356 Missing. In isoform 2.
Mutagenesis 353 – 353 H -> A. Partial loss of glucose-6-phosphatase activity.
Helix 336 – 340



Literature citations
Glycogen storage disease type Ia: four novel mutations (175delGG, R170X, G266V and V338F) identified.
Rake J.P.; ten Berge A.M.; Verlind E.; Visser G.; Niezen-Koning K.E.; Buys C.H.C.M.; Smit G.P.; Scheffer H.;
Hum. Mutat. 13:173-173(1999)
Cited for: VARIANTS GSD1A VAL-266 AND PHE-338;
Mutations in the glucose-6-phosphatase gene of 53 Italian patients with glycogen storage disease type Ia.
Stroppiano M.; Regis S.; DiRocco M.; Caroli F.; Gandullia P.; Gatti R.;
J. Inherit. Metab. Dis. 22:43-49(1999)
Cited for: VARIANTS GSD1A VAL-38; ARG-63; CYS-83; VAL-184; ARG-222; VAL-270; CYS-295; PRO-298 AND PHE-338;
Genetic heterogeneity of glycogen storage disease type Ia in France: a study of 48 patients.
Trioche P.; Francoual J.; Chalas J.; Capel L.; Lindenbaum A.; Odievre M.; Labrune P.;
Hum. Mutat. 16:444-444(2000)
Cited for: VARIANTS GSD1A ARG-5; VAL-38; PRO-54; CYS-83; ILE-108; LYS-110; ILE-111; GLU-184; ARG-188; THR-241; ARG-270; VAL-270; LEU-322; PHE-327 DEL AND PHE-338;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.