Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P07359: Variant p.Gly249Val

Platelet glycoprotein Ib alpha chain
Gene: GP1BA
Feedback?
Variant information Variant position: help 249 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change: help From Glycine (G) to Valine (V) at position 249 (G249V, p.Gly249Val). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from glycine (G) to medium size and hydrophobic (V) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help -3 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description: help In VWDP. Any additional useful information about the variant.
Other resources: help Links to websites of interest for the variant.


Sequence information Variant position: help 249 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 652 The length of the canonical sequence.
Location on the sequence: help ILYFRRWLQDNAENVYVWKQ G VDVKAMTSNVASVQCDNSDK The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences.
Human                         ILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDK

                              ILYLARWLRDNSNNVYLWKEGVEAKATTPNVDSVRCVNWKN

Mouse                         ILYFRHWLQENANNVYLWKQGVDVKDTTPNVASVRCANLDN

Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 17 – 652 Platelet glycoprotein Ib alpha chain
Chain 17 – 506 Glycocalicin
Topological domain 17 – 531 Extracellular
Domain 221 – 282 LRRCT
Disulfide bond 225 – 264
Disulfide bond 227 – 280
Mutagenesis 249 – 249 G -> A. No change.
Mutagenesis 249 – 249 G -> KD. Decreased binding to vWF.
Mutagenesis 249 – 249 G -> SV. Increased binding to vWF.
Beta strand 243 – 249



Literature citations
Mutation in the gene encoding the alpha chain of platelet glycoprotein Ib in platelet-type von Willebrand disease.
Miller J.L.; Cunningham D.; Lyle V.A.; Finch C.N.;
Proc. Natl. Acad. Sci. U.S.A. 88:4761-4765(1991)
Cited for: VARIANT VWDP VAL-249;
Expression of the phenotypic abnormality of platelet-type von Willebrand disease in a recombinant glycoprotein Ib alpha fragment.
Murata M.; Russell S.R.; Ruggeri Z.M.; Ware J.;
J. Clin. Invest. 91:2133-2137(1993)
Cited for: VARIANT VWDP VAL-249;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.