Home  |  Contact

UniProtKB/Swiss-Prot O43593: Variant p.Thr1022Ala

Lysine-specific demethylase hairless
Gene: HR
Variant information

Variant position:  1022
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  Disease [Disclaimer]
The variants are classified into three categories: Disease, Polymorphism and Unclassified.
  • Disease: Variants implicated in disease according to literature reports.
  • Polymorphism: Variants not reported to be implicated in disease.
  • Unclassified: Variants with uncertain implication in disease according to literature reports. Evidence against or in favor of a pathogenic role is limited and/or conflicting.

Residue change:  From Threonine (T) to Alanine (A) at position 1022 (T1022A, p.Thr1022Ala).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Change from medium size and polar (T) to small size and hydrophobic (A)
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  0
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Involvement in disease:  Alopecia universalis congenita (ALUNC) [MIM:203655]: A rare disorder characterized by loss of hair from the entire body. No hair are present in hair follicles on skin biopsy. {ECO:0000269|PubMed:12406339, ECO:0000269|PubMed:24334705, ECO:0000269|PubMed:9445480, ECO:0000269|PubMed:9736769}. Note=The disease is caused by mutations affecting the gene represented in this entry.
The name and a short description of the disease associated with the variant. For more information about the disease, the user can refer to OMIM, following the link provided after the disease acronym.

Variant description:  In ALUNC.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  1022
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  1189
The length of the canonical sequence.

Location on the sequence:   GTKNLCVEVADLVSILVHAD  T PLPAWHRAQKDFLSGLDGEG
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         GTKNLCVEVADLVSILVHADTPLPAWHRAQKDFLSGLDGEG

Mouse                         GTKNLCVEVSDLISILVHAEAQLPPWYRAQKDFLSGLDGEG

Rat                           GTKNLCVEVSDLISILVHAEAQLPPWYRAQKDFLSGLDGEG

Drosophila                    ------MDIKPSVIQRVPMEQQP------------------

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 1189 Lysine-specific demethylase hairless
Domain 946 – 1157 JmjC
Metal binding 1007 – 1007 Iron; catalytic
Metal binding 1009 – 1009 Iron; catalytic


Literature citations

Alopecia universalis associated with a mutation in the human hairless gene.
Ahmad W.; ul Haque M.F.; Brancolini V.; Tsou H.C.; Ul Haque S.; Lam H.; Aita V.M.; Owen J.; Deblaquiere M.; Frank J.; Cserhalmi-Friedman P.B.; Leask A.; McGrath J.A.; Peacocke M.; Ahmad M.; Ott J.; Christiano A.M.;
Science 279:720-724(1998)
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1); VARIANT ASP-337; VARIANT ALUNC ALA-1022;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.