Home  |  Contact

UniProtKB/Swiss-Prot O00255: Variant p.Glu184Asp

Menin
Gene: MEN1
Variant information

Variant position:  184
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Type of variant:  LP/P [Disclaimer]
The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance

Residue change:  From Glutamate (E) to Aspartate (D) at position 184 (E184D, p.Glu184Asp).
Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.

Physico-chemical properties:  Similar physico-chemical property. Both residues are medium size and acidic.
The physico-chemical property of the reference and variant residues and the change implicated.

BLOSUM score:  2
The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page

Variant description:  In MEN1.
Any additional useful information about the variant.

Other resources:  
Links to websites of interest for the variant.



Sequence information

Variant position:  184
The position of the amino-acid change on the UniProtKB canonical protein sequence.

Protein sequence length:  615
The length of the canonical sequence.

Location on the sequence:   FAVVGACQALGLRDVHLALS  E DHAWVVFGPNGEQTAEVTWH
The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.

Residue conservation: 
The multiple alignment of the region surrounding the variant against various orthologous sequences.

Human                         FAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWH

                              FAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWH

Mouse                         FAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWH

Rat                           FAVVGACQALGLRDVHLALSEDHAWVVFGSNGEQTAEVTWH

Bovine                        FAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAEVTWH

Sequence annotation in neighborhood:  
The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.

TypePositionsDescription
Chain 1 – 615 Menin
Mutagenesis 187 – 187 A -> F. Reduced interaction with KMT2A.


Literature citations

Mutation analysis of the MEN1 gene in Belgian patients with multiple endocrine neoplasia type 1 and related diseases.
Poncin J.; Abs R.; Velkeniers B.; Bonduelle M.; Abramowicz M.; Legros J.-J.; Verloes A.; Meurisse M.; van Gaal L.; Verellen C.; Koulischer L.; Beckers A.;
Hum. Mutat. 13:54-60(1999)
Cited for: VARIANTS MEN1 TRP-39; TYR-177; ASP-184 AND PRO-269; VARIANTS GLN-176; PRO-272 AND ALA-546; INVOLVEMENT IN ISOLATED HYPERPARATHYROIDISM;

Clinical testing for multiple endocrine neoplasia type 1 in a DNA diagnostic laboratory.
Klein R.D.; Salih S.; Bessoni J.; Bale A.E.;
Genet. Med. 7:131-138(2005)
Cited for: VARIANTS MEN1 VAL-144; ASP-161; ASP-184; LYS-184; ARG-186; MET-220; ARG-264; ARG-325; TRP-360; TYR-426; CYS-441 AND ARG-441;

Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.