Expasy logo

UniProtKB/Swiss-Prot variant pages

UniProtKB/Swiss-Prot P06400: Variant p.Asn803Lys

Retinoblastoma-associated protein
Gene: RB1
Feedback?
Variant information Variant position: help 803 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Type of variant: help LP/P [Disclaimer] The variants are classified into three categories: LP/P, LB/B and US.
  • LP/P: likely pathogenic or pathogenic.
  • LB/B: likely benign or benign.
  • US: uncertain significance
Residue change: help From Asparagine (N) to Lysine (K) at position 803 (N803K, p.Asn803Lys). Indicates the amino acid change of the variant. The one-letter and three-letter codes for amino acids used in UniProtKB/Swiss-Prot are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB.
Physico-chemical properties: help Change from medium size and polar (N) to large size and basic (K) The physico-chemical property of the reference and variant residues and the change implicated.
BLOSUM score: help 0 The score within a Blosum matrix for the corresponding wild-type to variant amino acid change. The log-odds score measures the logarithm for the ratio of the likelihood of two amino acids appearing by chance. The Blosum62 substitution matrix is used. This substitution matrix contains scores for all possible exchanges of one amino acid with another:
  • Lowest score: -4 (low probability of substitution).
  • Highest score: 11 (high probability of substitution).
More information can be found on the following page
Variant description: help In RB. Any additional useful information about the variant.


Sequence information Variant position: help 803 The position of the amino-acid change on the UniProtKB canonical protein sequence.
Protein sequence length: help 928 The length of the canonical sequence.
Location on the sequence: help PHIPRSPYKFPSSPLRIPGG N IYISPLKSPYKISEGLPTPT The residue change on the sequence. Unless the variant is located at the beginning or at the end of the protein sequence, both residues upstream (20) and downstream (20) of the variant will be shown.
Residue conservation: help The multiple alignment of the region surrounding the variant against various orthologous sequences. 
Human                         PHIPRSPYKFPSSPLRIPGG-NIYISPLKSPYKISEGLPTPT

Mouse                         PHIPRSPYKFSSSPLRIPGG-NIYISPLKSPYKISEGLPTP

Rat                           PHIPRSPYKFSSSPLRIPGG-NIYISPLKSPYKISEGLPTP

Chicken                       PHIPRSPYQFSNSPRRVPAGNNIYISPLKSPYKFSDGFHSP
Sequence annotation in neighborhood: help The regions or sites of interest surrounding the variant. In general the features listed are posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. The "Sequence annotation in neighborhood" lines have a fixed format:
  • Type: the type of sequence feature.
  • Positions: endpoints of the sequence feature.
  • Description: contains additional information about the feature.
TypePositionsDescription
Chain 2 – 928 Retinoblastoma-associated protein
Region 763 – 928 Interaction with LIMD1
Region 771 – 928 Domain C; mediates interaction with E4F1
Modified residue 788 – 788 Phosphoserine
Modified residue 795 – 795 Phosphoserine
Modified residue 807 – 807 Phosphoserine; by CDK1 and CDK3
Modified residue 810 – 810 N6-methyllysine; by SMYD2
Modified residue 811 – 811 Phosphoserine; by CDK1 and CDK3
Modified residue 821 – 821 Phosphothreonine; by CDK6
Modified residue 823 – 823 Phosphothreonine
Mutagenesis 821 – 821 T -> A. Abolishes interaction with Pocket domain; when associated with A-826.



Literature citations
Germline mutations in the RB1 gene in patients with hereditary retinoblastoma.
Liu Z.; Song Y.; Bia B.; Cowell J.K.;
Genes Chromosomes Cancer 14:277-284(1995)
Cited for: VARIANTS RB GLN-72; TYR-549 AND LYS-803;
Disclaimer: Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. They are not in any way intended to be used as a substitute for professional medical advice, diagnostic, treatment or care.